KEGG   Rhizobium sp. N731: AMK02_CH01488Help
Entry
AMK02_CH01488     CDS       T04809                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00473  D-Alanine metabolism
rhx01100  Metabolic pathways
rhx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rhx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMK02_CH01488 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AMK02_CH01488 (alr)
Enzymes [BR:rhx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AMK02_CH01488 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rhx01011]
 Precursor biosynthesis
  Racemase
   AMK02_CH01488 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANK85110
LinkDB All DBs
Position
complement(1487301..1488464)
Genome map
AA seq 387 aa AA seqDB search
MTDFPILSEDDDLFTSAGLRLTVDLSALTENWRDMARRSGAARAAAVVKADAYGTGIEDA
GEALYLAGARDFFVATVDEGVTLRLYAPEARIFVLSGIWPGTERRFFDNDLVPVISSDEQ
LAFWMAVLADYGDYPCALHVDTGFNRLGLHIDDAVALANDVSRPASFAPVLVMSHLACGD
DPSHAMNRQQLESFRRVTAAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVSGM
ANPMRPVATAEARVIQVRTVEAGETVSYGRALQLGRESRLAIVSAGYADGYMRSQSSGGV
PLRQAVPQGGQGFIAGHKVPVAGRITMDLTIFDITDLPENAVRAGDYVELFGKNMPLDDV
ARAAGTIGYEILTSMGLRHERRYVAEA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacagattttcccatcctctccgaagacgacgatctcttcacttccgcaggcctgcgg
ctgaccgtcgacctgagcgcgctcacggaaaattggcgcgacatggcgcgccgctcaggt
gcagcgcgcgccgcagccgtcgtcaaggcggacgcctacggcacaggcatcgaggatgcc
ggcgaagcgctctacctcgcaggcgcccgggatttcttcgtcgcgaccgtcgatgagggc
gtcacccttcgcctctatgcgcccgaggcgcgcatcttcgtgctctcgggcatatggccg
ggcacggaacggcggttcttcgacaatgatctggtgccggtgatttcctccgacgagcag
ctcgccttctggatggcggtgcttgccgattacggcgattatccctgcgcgctgcatgtc
gataccggcttcaatcggctgggattgcacatcgacgacgcggtggctctcgccaatgac
gtctcgcggcctgcaagcttcgcgccggtgctggtcatgagccacctcgcctgcggcgac
gatcccagccatgccatgaaccggcagcaactcgaatcgttccgcagggttacggccgcc
tatgaaggcatcgattcaagtcttgccgcctcggccggcatctttctcggcgaggattat
catttcgacctgacccggccgggcatcgcgctctatggcggcgaggcggtcagcggcatg
gcgaacccgatgcggccggtcgcgaccgcggaagcgcgcgtcatccaggttcggaccgtc
gaggccggcgagaccgtcagctatggacgggcgctgcagcttggccgtgaaagtcggctg
gcgatcgtctcagccggctacgccgacggttatatgcgcagccaatcaagcggcggcgtg
cctctgcgccaggctgtgccgcaaggcggacaaggtttcatcgccgggcataaggtaccg
gttgccggccggatcaccatggacctgacgatcttcgatatcaccgacctgccagagaac
gcggtgcgcgccggcgattatgtcgagctgttcggaaagaacatgcctctcgacgacgta
gcgcgggcagcgggcacgatcggatacgagatcctcaccagcatggggctgcgtcacgaa
cggcgctatgtggccgaggcgtag

DBGET integrated database retrieval system