KEGG   Rhodoferax koreense: RD110_02310Help
Entry
RD110_02310       CDS       T04721                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rhy  Rhodoferax koreense
Pathway
rhy00564  Glycerophospholipid metabolism
rhy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RD110_02310
Enzymes [BR:rhy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RD110_02310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 HI0933_like NAD_binding_8 Lycopene_cycl 3HCDH_N GIDA Pyr_redox Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: APW36189
UniProt: A0A1P8JR28
LinkDB All DBs
Position
489162..490772
Genome map
AA seq 536 aa AA seqDB search
MTPSTPSASPLPTRRAELLARLAEPRSYDVAIIGGGATGLGVALDAASRGYSVVLVESHD
FAKGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLPFIMPSYKFWE
TPFYGIGLKMYDALAGKAGLGPTEFLGRSKTLHYLPTAQPAGLKGGVKYWDGQFDDARLA
LALARTAASHGALLVNYCAADELIHEEGQLVGLRCTDREGGARFTIRARCIVNAAGVWVD
DFRQKDGEAVGRKTQPMVAPSQGVHVVVDREFLPTDHALLVPKTTDGRVLFAVPWLGKTI
LGTTDTPRHDLDREPRPFKEEIEFILRESARYLSRAPTRADVKSVWVGLRPLVKPQDDDG
DNTKGLSREHTVLVSKTGLVTVTGGKWTTYRAMAEDVLDKCLAAQLLQPLHDSVTADLRL
VGGGRDGDAPVHRRISDAPGIAAYGSEQDEVQAMPGSGNALGGGLTEGMVRFAARFEYAR
TVEDVLARRSRLLFLDARLAASMAGAVAGILREETGVDPQSEAFDRLAALYLTLPE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaccccttccacaccttccgccagcccattgcccacccgccgcgccgagctgctcgcc
cgcctggccgagcctcggtcgtacgacgtggccatcatcggcggtggagccacgggcctg
ggcgtggcgctggacgcggcctcgcgcggctacagcgtggtgctggtcgagtcgcacgat
ttcgccaagggcacttcgtcgcgcgccaccaagctcgtgcacggcggcgtgcgttacctg
gcgcaaggcaacatcgcgctcgtgcgcgaggcgctgcacgaacgcacgacgctgctgcac
aacgcgccccacctggcgcagccgctgccgttcatcatgccctcgtacaagttctgggag
acgccgttctacgggatcggcctgaagatgtacgacgccttggccggcaaggccggtctg
ggccccacggaattcctgggccgcagcaagaccctgcattacctgcccaccgcgcagccc
gcgggcctgaagggcggcgtgaaatactgggacggccagttcgacgacgcgcgcctggcg
ctggccctggcgcgcaccgccgcctcccacggcgccttgctggtgaactactgcgcggcc
gatgaactcattcacgaagagggccaactcgtcggcctgcgttgcaccgaccgcgaaggc
ggcgcgcgcttcaccatccgcgcacgttgcatcgtcaatgctgcgggtgtctgggtcgac
gatttccgccagaaggacggcgaagccgtggggcgcaagacgcagcccatggtcgcgccg
agccagggcgtccatgtggtggtggatcgcgagttcctgcccaccgaccatgcgctgctc
gtgcccaagaccaccgacggccgcgtgctgttcgccgtgccctggctgggcaagaccatc
ctcggcaccaccgacacgccgcgccacgacctggaccgcgagccgcgcccgttcaaggaa
gagatcgaattcatcctgcgcgagtccgcgcgttacctgagccgcgcgcccacgcgggcc
gacgtgaaaagcgtgtgggtcggcctgcgtcctttggtcaagccacaggacgatgatggc
gacaacaccaagggcttgagccgcgaacacacggtgctggtcagcaagaccggcctggtc
accgtgaccggcggcaaatggaccacctaccgcgccatggccgaggacgtgctggacaag
tgcctggccgcccagttgctgcagccgctgcacgacagtgtgacggccgacctgcgcctg
gtgggcggcggccgcgacggcgacgcgcccgtacaccgccgcatcagcgacgcacccggc
atcgccgcctacggcagcgaacaggacgaagtgcaggccatgccgggttccggcaacgcc
ctgggcggtggcctgaccgaaggcatggtgcggttcgcggcgcgtttcgagtacgcgcgg
accgtggaagacgtgctggcgcggcgctcccggttgctgttcctggatgcccggctcgcg
gcctcgatggccggggcggtggcggggatcctgcgagaggagaccggcgtggatccgcaa
tccgaggcctttgatcggctggccgcgttgtatctgaccttgccggagtga

DBGET integrated database retrieval system