KEGG   Rhizobium sp. IRBG74: BN877_I0861Help
Entry
BN877_I0861       CDS       T02867                                 

Gene name
sodB1
Definition
(GenBank) superoxide dismutase, iron/manganese cofactor
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rir  Rhizobium sp. IRBG74
Brite
Enzymes [BR:rir01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BN877_I0861 (sodB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
854517..855119
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS
FGTNAGLFNNAAQHYNHVHFWKWMKKGGGGNKLPGKLEQAIASDLGGYDKFKADFIAAGT
TQFGSGWAWLSVKNGKLEISKTPNGENPLVHGAEPILGVDVWEHSYYIDYRNLRPKYLEA
FVDNLINWDYVLERYEAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaacttcccgaactcccctacgactacgacgcgcttgcaccttacatgtcg
cgcgagacgctcgagttccatcacgacaagcaccacaaggcgtatgtcgacaacggcaac
aagcttgcagctgaagccggtctttccgacctgtcgctcgaagaagtcgtgaagaagtcc
tttggcaccaatgccggtctcttcaacaatgcggcccagcactacaaccacgttcatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccgggcaagcttgagcaggca
attgcctccgatctcggcggttacgacaagttcaaggccgatttcatcgcagccggcacc
acgcagttcggctccggctgggcgtggctgtccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctggttcacggtgcagaaccgatccttggcgtcgac
gtctgggaacactcctactacatcgactaccgcaacctgcgtccgaagtaccttgaagcc
ttcgtcgataacctcatcaactgggactacgtcctggagcgttacgaagctgctgccaag
taa

DBGET integrated database retrieval system