KEGG   Rhizobium sp. IRBG74: BN877_I1068Help
Entry
BN877_I1068       CDS       T02867                                 

Definition
(GenBank) putative alanine racemase (alr)
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rir  Rhizobium sp. IRBG74
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rir00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN877_I1068
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BN877_I1068
Enzymes [BR:rir01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BN877_I1068
Peptidoglycan biosynthesis and degradation proteins [BR:rir01011]
 Precursor biosynthesis
  Racemase
   BN877_I1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1047563..1048738)
Genome map
AA seq 391 aa AA seqDB search
MTDDLEDTFAETETDAFEHAPLRLTVDLGALADNWRDMRRRSGKARTAAVVKADAYGLGI
EDCGAALYHAGARDFFVATVAEGETLRSYAPEARIFVLSGIWQGQERQVFDNDLVPVLAS
EEQLSFWMATVAERGDHPCALHVDTGFNRLGLPLDDALFLADDVTRPASFDPVLVLSHLA
CADTPSSPMNRAQLESFRMVSTAFEGIESSLSASAGIFLGPDYHFDLTRPGIALYGGEAV
NDVANPMRPVAKAEARIIQIRDAGEGQTVSYGGTFLLKRASRLAIATVGYADGYQRSLSG
SGIPLREMGHGGAYGVVNGHKVPVAGRVTMDLTIFDVTDVPANAIRTGDYVELFGPNVPV
DETARAAGTIGYEMLTGLGLRYERQYLMADD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgacctcgaggatacattcgctgaaaccgaaaccgacgctttcgaacacgcg
ccactgcggctgaccgtcgatctcggtgcgctggccgataattggcgggacatgaggaga
cgctccggcaaggcgcggacagcggccgtcgtgaaggccgatgcctatggcctcggcatc
gaggattgcggcgcagcgctctaccatgccggcgcgcgcgacttcttcgtggcaacggtt
gccgagggtgagaccctgcgttcctatgcacctgaagcacgcatcttcgtcctgtcaggc
atctggcagggccaggaacggcaggtcttcgacaatgatctggtgccggttcttgcctcc
gaggagcaactctccttctggatggcgacggtggccgagcgtggcgatcacccctgcgca
ctgcatgtggacaccggcttcaaccgtctcggactgccgctcgacgatgccctgtttctg
gccgacgacgtgacccggccggcaagttttgacccggttctggtgctgtcccatctcgcc
tgtgccgacacgccctcctcgccgatgaacagggctcagctcgaatcattccggatggtt
agcactgctttcgaaggtatcgaatcaagcctctcggcttccgccggtatctttctcggc
ccggattatcatttcgaccttacccgtcccggcatagcgctctatggcggagaggcggtc
aacgacgttgcaaatcccatgcggccggtcgccaaagcagaagcgcgcatcatccagatc
cgcgatgcgggcgaaggccagaccgtcagttatggcggcacctttctgctgaaacgcgca
agccgcctcgccatcgcgactgtcggttacgcggacggataccagcgttcgctgtccggt
tccggcattccgctgcgcgaaatgggtcatggcggcgcatacggtgtcgtcaacggccac
aaggtgccggttgctggccgcgtcaccatggacctcaccatcttcgacgtgacggatgtt
ccggccaatgccattcgaaccggagattatgtcgagcttttcggtcccaatgtgcccgta
gacgagactgcacgggcggcaggaacgatcggctatgagatgttgacaggacttggtctg
cgatatgagcggcaatatctgatggcggatgactga

DBGET integrated database retrieval system