KEGG   Rivularia sp. PCC 7116: Riv7116_1977Help
Entry
Riv7116_1977      CDS       T02364                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
riv  Rivularia sp. PCC 7116
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:riv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Riv7116_1977
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Riv7116_1977
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Riv7116_1977
   00680 Methane metabolism
    Riv7116_1977
Enzymes [BR:riv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Riv7116_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2444500..2447559
Genome map
AA seq 1019 aa AA seqDB search
MSTVLYTDAQAVNIYPASDLFLRHRLQIVEEVWELVLREECGQQMVDLLRQLRDLCSPEG
QATDNQASSVSSLIENLSINEAIRAARGFALYFQLINIVEQDYEQKQQLTRYEEEERSGE
KETLPPIIYSSNQQVEDVHLNSGVNADLLVKSWQAKPNSKDKGTFAELFPKLFKLNVPPA
QIQRLIAQLDVRLVFTAHPTEIVRPTIREKQRRVVDLLQNLDASEKRSGNTSAGVYSWET
TQLRSQLLEEIRLWWRTDELHQFKPSVLDEVDYALHYFQEVLFEAIPQLYQRLEYSLNST
FSRLEPPSKSFCQFGSWVGSDRDGNPSVTPEITWQTACYQRHMVLNKYIDSAKGLIELLS
VSLHWSDVLPDLLESLEIEQSQMSEVYDELALRYRQEPYRLKLAYVVKRLENTRERNSAL
RKREIIKDDKAPIYRSVSEFLADLRLIQRNLSETGLKCQQLENLLTQVEIFGFNLTQLDI
RQESTRHSDAIGEILEYLGILDQKYDDLPEEEKIAWLTKELQTRRPLIPAQLPFGDKTNE
IVETMRLVHSLQKEFGCNICQTYIISMCRSVSDVLEVLLLAKEAGLYDPGTAVGTIRVIP
LFETVEDLQRSRQVMKDLFSLPLYRALLAGGYEVYEEGKETKQEGESSPLYPNLQEIMLG
YSDSNKDSGFLSSNWEIHKAQKSLQHIAEQYGLGVRIFHGRGGSVGRGGGPAYEAILAQP
GKSINGRIKITEQGEVLASKYSLPDLALYNLETITTAVIQASLLRAGFDDIEPWNEIMEE
LAARSRSHYRDLIYEQPDFIDFFNQVTPIEEISQLQISSRPARRPSGKKGLSSLRAIPWV
FSWTQTRFLLPAWYGVGTALQEFLNEAPEDHIQLLQCFYRKWPFFKMVISKVEMTLAKVD
LQMGRHYVEELSKDEDKQRFDRVFNQISSEYYLTRNLVLKITGHERLLDGDPVLQRSVQL
RNGTIVPLGFIQVSLLKRLRDSKNNASSGVIHSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgttttatacactgacgctcaggcagtaaatatctaccccgcatcagatttg
tttttgcgccatcgcctgcaaatcgtagaggaagtgtgggaattagttctccgtgaagaa
tgcggacaacaaatggtagatctcctcagacaactacgcgatttatgctctccagaagga
caagcaactgataaccaagcttcttcggtatcaagcttaattgaaaatttgagcattaat
gaagcaattagagcggctcgtggatttgctttgtattttcaattaataaatatcgtagaa
caggattacgaacaaaaacagcagctaactcgctacgaagaagaagagcgatctggagag
aaagaaactttaccgcctattatttattcgagcaatcaacaggttgaagatgttcatctc
aacagcggcgttaatgcagatttactagtcaaaagttggcaagccaaaccaaattcaaaa
gacaaagggacatttgccgaactatttcccaaattattcaagttaaacgtacctccggca
cagattcaacggttaattgcacaattggatgtgcgtttggtgtttacggctcaccccact
gaaattgtccgtcccaccatccgagaaaaacagcgacgagttgtagatttactacaaaat
ctggatgcatccgaaaaacgttctggtaatactagcgccggagtttattcttgggaaaca
acccaactccgctctcaattgcttgaagagatacgtttgtggtggcgtaccgatgaacta
catcaatttaaaccaagcgtacttgatgaagtagactacgcgctgcattacttccaagaa
gttttatttgaagcaattcctcagctttaccagcgtctggagtactcattaaattcgact
ttttcgagacttgagccacctagtaaaagcttttgccagtttggttcttgggtaggttcc
gatagagatggaaatccttccgtaacaccggaaattacttggcagactgcttgctatcaa
cgccatatggtgttaaacaaatacattgattctgctaagggtttaattgaattactcagc
gtatcgctacactggagcgacgtactacctgacttattagaatctctggaaattgaacag
tcccagatgagcgaagtttatgatgaattagcattacgctatcgtcaagaaccttatcgt
ttaaagctcgcttatgtcgtaaaaagactagaaaacacgcgggaacgtaattcagcattg
cggaagcgggaaatcattaaagacgataaagctccaatttaccgttctgtttcagaattt
ttagccgatttgaggttaattcaacgcaacttgtcagaaacgggtttaaagtgtcagcaa
ttggaaaatctcctgacacaagttgaaatttttggctttaatttgacccaattagatatt
aggcaagaatcaactcgtcacagcgatgcaatcggcgaaattctcgaatatctaggaatt
ttagaccaaaagtacgatgacttaccagaagaagaaaaaattgcttggttaactaaagaa
ctgcaaacaagaagacctctaattcccgctcagctaccgtttggggataaaaccaacgaa
atcgtggagacgatgcgcttagtgcattcgttgcaaaaagaatttggttgcaacatttgc
caaacttacattatcagtatgtgtcgttccgtcagcgatgtgctggaagtattgttatta
gctaaagaagcaggactttatgaccccggaacggctgtaggtacaatccgagtcataccc
ttatttgaaacagtagaagatttacagcgttcgagacaagtaatgaaagacttgttttct
cttcctttatatcgcgctttacttgccggaggatatgaagtttacgaggaaggcaaggaa
acaaagcaagaaggcgaaagttctcctttatatcccaacttacaggaaatcatgttgggg
tattctgacagtaataaagactctggcttcctcagcagtaactgggagattcacaaagcc
caaaaatctttgcagcatatagcagaacaatacggcttgggcgtgcgaatattccacgga
cggggtggttccgtaggacgcggcggcggaccagcttatgaggcaattttggcgcaaccg
ggcaaaagtattaacggtcggataaaaattaccgaacaaggtgaagttttagcttctaaa
tattccctaccggatttagcactatacaatctcgaaacaattaccactgccgtaattcaa
gccagtttattgcgtgccgggtttgacgatatcgaaccttggaacgaaatcatggaagaa
ttagcagcgcgatcgcgttctcattatcgagatttaatctacgaacaaccggattttatt
gactttttcaatcaagttacccccatagaagaaattagtcagttacaaattagttctcgt
ccggctcgtcgtccgtcgggtaagaaaggcttgagcagtttgcgtgcaattccctgggta
tttagctggacgcaaactagatttttgctacctgcttggtatggagtaggtacggcgttg
caagagtttcttaatgaagctccagaagaccacattcaattattgcaatgcttttacaga
aaatggccgtttttcaaaatggttatttctaaggtagaaatgaccttggctaaagtcgat
ttacaaatgggacggcattatgtagaagagctatctaaagatgaagataagcagcgtttc
gatcgagtattcaaccagatttctagcgagtactatctgacgagaaatttagtgctgaaa
atcaccgggcacgaaagactcttggatggagatccagttttacaacgttccgtacaatta
agaaatggtactattgtacctttagggtttatccaagtatctttactcaagcgtttacgt
gatagtaaaaacaatgcgagttctggagtcattcactcgcgctacagtaaaggagaattg
ctccgaggggcgcttttaactattaacggaatcgctgcgggcatgagaaatactggttga

DBGET integrated database retrieval system