KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_07565Help
Entry
RLEG3_07565       CDS       T03009                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rlb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RLEG3_07565
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RLEG3_07565
Enzymes [BR:rlb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RLEG3_07565
Peptidoglycan biosynthesis and degradation proteins [BR:rlb01011]
 Precursor biosynthesis
  Racemase
   RLEG3_07565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
unnamed:163047..164180
Genome map
AA seq 377 aa AA seqDB search
MDSDIFVSRTRTATTLQGATGYLTIDLAALGRNYRKLVSMLAPVRAGAVVKADAYGLGAE
RVARTLHSEGCRHFFVAQFVEAVRLRPALGHDAQIFVLNGLQPGNEIACAEMGIVPVLNS
LAQWRQWSAAARILKRCLPAVLQFDTGMSRLGFPREERAELAAALRDRSNVEILFIMSHL
ASADDMDSEQNGDQFTEMSRIADDFPGFDISFANSGGVFLGDAYHCVLARPGIALYGGAP
NAGEKKPMEPVVSLDVAVVQTRTVPAGAKVGYGGAHVTQRETRLATIAAGYADGLPRCLS
DRGAVYFKGIRLPIVGRVSMDSATVDVSALPEGALTFGSLVEVLGRHQTLEDIARDAGTI
SYEILTGLGDRYDRQYR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgatattttcgtttcccgcacacgcactgccacgaccttgcagggagccacg
ggctatctgacgatcgatcttgccgccctcggccggaactatcgcaagctcgtgtcgatg
ctggcacctgtccgtgccggggccgtcgtcaaggctgacgcctatggccttggcgctgag
cgggtggcgagaacgcttcacagtgaaggttgcaggcatttcttcgtcgcccagtttgtc
gaggccgtgaggctcagaccggcccttgggcacgacgcccagattttcgtgctgaacggc
ttgcagccgggcaacgagatcgcctgcgccgagatgggcatcgtcccggttctcaattcg
ctggcacagtggcggcaatggtcggcggcggcgcgcattctgaagcgctgcctgccggcc
gtcctacaattcgacaccggcatgtcgcggctcggttttcccagggaagagcgagcagag
ctggcggcggcacttcgcgaccgcagcaatgtggaaatcctgttcatcatgagccatctg
gcttcggccgatgacatggacagcgagcagaacggcgaccagtttaccgagatgtcccgc
atcgccgacgattttccgggcttcgatatttccttcgccaattccggcggcgttttcctg
ggcgacgcctatcactgcgtgctcgcccgcccgggcatcgcgctttatggcggcgctccg
aacgccggcgagaagaaaccgatggaaccggtcgtcagccttgatgtcgccgtcgtgcag
acgcgcaccgtgccggcgggtgcgaaggtcggctatggcggcgcgcatgtcacgcaacgg
gaaacgcgtctcgccaccattgccgccggctatgccgatggcctgccgcgatgcctcagc
gaccgcggcgccgtctatttcaagggcatccgtctgccgatcgtcggccgcgtgtcaatg
gacagcgcgaccgtcgacgtgtcagcactgcccgaaggggcgctgaccttcggcagtctc
gtcgaagtgcttggccgccatcagacgctcgaggacatcgcgcgcgacgccggcacgatt
tcttacgaaatcctaaccggcctgggcgatcgttacgacaggcaatatcgctga

DBGET integrated database retrieval system