KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_09760Help
Entry
RLEG3_09760       CDS       T03009                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rlb00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    RLEG3_09760
Enzymes [BR:rlb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RLEG3_09760
DNA repair and recombination proteins [BR:rlb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RLEG3_09760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
unnamed:complement(623732..626377)
Genome map
AA seq 881 aa AA seqDB search
MASDKLSTYRSKRDFQKTAEPSGEKRLAGSNRRRFVIQKHDATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGKKSPE
QALAKGDFKFILEGKRLHGSFVLVRMRNDRNGGNRTNWLLIKHHDEFSVENNGQAILEEN
DTSVASGRTMEMIAAGKGRKPKPFMIDGGDIQADAVWDSNHGLAAEERKEDAGGGRKSKP
ATKVDLPDFIAPQLCQTLERPPAGTGWIHEIKFDGYRIQMRVLDGEATLKTRKGLDWTDK
YPEIAEAASALPDAIIDGEICALDDTGAPDFAALQAALSEGKTRELVYFAFDLLYQGGVD
LRSLPLVERKARLQSLLSDAGNDPRIRFVEHFETGGDAVLRSACKLSLEGIVSKEADAPY
QSGRTESWAKSKCRSGHEVVIGAYAKTNGKFRSLLVGVYHGDHFVYVGRVGTGYGAKKVE
TLLPKLKAIETAKSPFTGIGAPKKEAEVTWLKPELVAEIEFAGWTADGIVRQAAFKGLRE
DKPAKEVKAERPAKPGQTDVPQPAVQAKARPVRRKSAKAEVMGVLISNPDKPLWPDANDG
EAVTKEELARYYEAVGSWLIEHIKGRPCSIIRAPDGIGGEQFFQRHAMPGTSNLLELVKV
FGDKKPYLQIDRVEGLAAVAQIGAVELHPWNCEPHQPEVPGRLVFDLDPGPDVPFSAVVS
AAREMRDRLDALGLISFCKTTGGKGLHVVTPLAVNKRKPLSWAEAKGFAHDVCQQMARDN
PDLYLIKMTKSLRNGRIFLDYLRNDRMATAVAPLSPRARPGATVSMPLTWTQVKSDLDPK
RFTIRTVPALLSKSSAWEDYSDGKRSLEQAIKRLGKVSEVA
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgacaaactatcgacgtatcgatcgaagcgcgactttcaaaaaacggccgag
cctagcggtgaaaaacggctcgcgggcagtaaccgccgtcgcttcgtcatccagaaacac
gacgccacccggttgcattacgatctgagactcgagctcgatggcgtcttcaaatcctgg
gcggtcaccaaaggcccgtctctagacccgcacgacaagcggctggcagttgaggtcgag
gatcatccgctcgactacggcgatttcgaaggcaccattccgaaaggtcagtatggcggt
gggacggtcatgctctgggatcggggctattgggaaccggaaggaaagaagagccccgag
caggcgctcgccaagggtgactttaagttcatcttggaaggcaaacgcctgcacggcagc
ttcgtactggtgcgcatgcgcaatgatcgcaacggcggcaaccggacaaattggctgctc
atcaaacaccatgatgagttctccgtcgaaaacaatggccaagccatcctcgaggagaac
gacacctctgtcgcctccggccgaaccatggagatgattgccgccggcaagggacgaaag
cccaagcctttcatgattgatggtggcgacattcaggccgatgccgtctgggacagcaat
cacggactggctgccgaagagcgaaaagaggacgccggaggcggtcggaaatcgaaaccg
gccacaaaggtcgatcttccggatttcattgcgccacagctctgccagacactggaacgc
cctccggccggcaccggctggattcacgagatcaagttcgacggttaccggatccagatg
cgcgtgctggatggtgaggcgacgctgaagaccaggaaagggctcgactggacggacaaa
tatcccgagatcgccgaggcggcatcggcattgcccgatgcgatcatcgacggcgagatc
tgcgccctcgacgatactggcgctcctgatttcgcggccctgcaggcggccctttcggaa
ggcaagacccgcgaactcgtctatttcgccttcgatctactctatcagggaggcgtggat
ttgcgatctctgccactcgtcgagcgcaaggcgcggcttcaaagccttctgtccgacgcc
ggcaacgatccgcgcatccgtttcgtcgagcatttcgagactggcggcgatgcagttctc
cggtctgcctgcaagctctcactggaaggcatcgtctcgaaagaagcggatgcaccctat
caatccggccgcaccgaaagctgggcgaagtcgaaatgccgctccggccacgaggtggtg
atcggcgcctatgccaagaccaacgggaaattccgatccctgctggtcggcgtctatcac
ggcgaccacttcgtctatgtcggccgcgtcggcacgggatatggcgcgaagaaagtggaa
acgctgctgccgaagttgaaagcgatcgagacggcgaaatcgccgttcaccggcattggc
gcgccgaagaaggaggccgaggtcacctggctgaaacccgagctcgtggcggaaatcgaa
ttcgcaggctggaccgccgacggcattgtccggcaggcggccttcaagggactgcgggaa
gacaagccggcgaaagaggtcaaggctgaacggccggcgaagcccgggcaaactgacgta
ccgcagccggcggtgcaggcgaaggccaggcccgtccgccgaaaaagcgccaaggccgag
gtcatgggggtgctgatttcaaacccggacaagccgctatggccggatgcgaatgacggc
gaagcggtcaccaaggaagagctggcccgctactacgaagccgtcggttcctggctgatc
gagcacatcaagggacggccgtgttccatcatccgcgcgcccgacgggatcggcggcgag
cagtttttccagcgccatgcgatgcccggcacctcgaaccttctcgaactggtcaaggtc
tttggcgataaaaagccctatctgcaaatcgaccgggtcgaaggcttggccgccgtcgcg
cagatcggcgcggtcgagctgcacccctggaattgcgaaccgcatcagcccgaggtgccc
gggcgtctcgtcttcgaccttgatccaggtccggacgtgccgttctccgctgtggtttcg
gcggcccgggaaatgcgggaccgtctcgacgcgctgggcctgatcagcttttgcaagacg
actggcggcaagggtctgcacgttgtcactccgctcgcggtcaacaagcgcaagccgctt
tcgtgggctgaagcgaagggttttgcgcacgatgtgtgccagcagatggcgcgcgacaat
cccgatctctatctgatcaaaatgacgaagagcctgaggaacggccggatcttcctcgac
tatctgcgcaacgaccggatggcgacggcggtggcgcctttgtcaccgcgcgcacggccg
ggcgccaccgtctcgatgccactgacctggacgcaggtcaaatcggatctggaccccaag
cgcttcactatccgcaccgttccggccttgctgtcaaaatcttccgcctgggaggattac
agtgatggcaagcgttcgctggaacaggcgatcaagcgcctcggcaaagtctccgaagtg
gcttga

DBGET integrated database retrieval system