KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1294Help
Entry
RL1294            CDS       T00402                                 

Gene name
lig
Definition
(GenBank) putative DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:rle00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RL1294 (lig)
   03410 Base excision repair
    RL1294 (lig)
   03420 Nucleotide excision repair
    RL1294 (lig)
   03430 Mismatch repair
    RL1294 (lig)
Enzymes [BR:rle01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RL1294 (lig)
    6.5.1.6  DNA ligase (ATP or NAD+)
     RL1294 (lig)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     RL1294 (lig)
DNA replication proteins [BR:rle03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    RL1294 (lig)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     RL1294 (lig)
DNA repair and recombination proteins [BR:rle03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     RL1294 (lig)
   NER (nucleotide excision repair)
    Other NER factors
     RL1294 (lig)
   MMR (mismatch exicision repair)
    Other MMR factors
     RL1294 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
1359141..1360766
Genome map
AA seq 541 aa AA seqDB search
MKAFADLLDRLVLTPSRNGKLKLLTDYFRDTPDPDRGYGLAAIAGTLEVRNVKPAMLREL
VLERMDEVLFRYSYDYVGDLAETISLVWDNERDIDRSALAQPRLGEVVTGMNALGRTEVR
SYVRDLLDRLDSSGRFAFIKLATGAMRIGVSARLAKQALADLGDKDVTEIETLWHGLQPP
YETLFEWLADGGEKPVLATPAIFHSVMLANAVEEGDLTGLDPVNYAAEWKWDGIRVQLSR
SGDRRKIYSRSGDDISGAFPDILDAISFSGVVDGELLVGGTARSNSPTRTFSDLQQRLNR
KTVTAKMLGDYPAFIRTYDLLFDGDDDVRGRTYVDRRDRLTEIIDRAPHDRFDLSPLVLF
SSWEELDTLRAAPPDPVIEGVMIKRRDSVYQAGRMKGPWFKWKRNPYNVDAVLMYAQRGH
GKRSSYYSDFTFGVWADDEDGEQLVPVGKAYFGFTDAELEVLDKFVRNNTTERFGPVRAV
RADKDFGFVVEVAFEGINRSTRHKSGVAMRFPRIARLRPDKPSYEADRLRTLIAMIEAKP
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgccgatctcctcgaccgcctggtgctgacccccagccgcaacggcaag
ctgaagctgctcaccgactattttcgcgacacgccggatccggaccgcggctacggcctt
gccgccattgccggcacgctggaggtgcgcaacgtcaagcccgccatgctgcgcgagctg
gtgctggagcgcatggacgaggtgctgtttcgctattcctacgactatgtcggcgatctt
gccgaaaccatctcgctggtctgggacaatgagagggatatcgaccgctcggcacttgcc
cagccgcgtctcggcgaggtcgtcaccggtatgaatgccctcggccgcaccgaagtgcgc
agctacgtccgcgatcttctcgaccggctggattcgtccggccgtttcgccttcatcaag
cttgccaccggcgccatgcgcatcggcgtttccgcccgccttgccaagcaggcgctcgcc
gatctcggcgacaaggacgtcaccgagatcgaaaccctctggcatggcctgcagccgccc
tatgagacgctgttcgaatggctggcggatggcggcgaaaagccggtgctggccaccccg
gcgatcttccactccgtcatgctcgccaatgcggtggaggagggggatctgaccggtctc
gatccagtgaattatgccgccgaatggaaatgggacggcatccgcgtccagctctcccgc
tccggcgacaggcgcaagatctattcccgctccggcgacgacatatcaggcgcctttccc
gatattctcgacgcaatcagtttttccggcgtcgtcgacggcgagctgctggtcggcggc
accgcccgctccaacagcccgacccgcaccttctccgacctgcagcagcgcctgaaccgc
aagacggtgacggcaaagatgcttggcgattaccccgccttcatccgtacctatgacctg
ctcttcgatggcgacgacgatgtccgcggccgcacctatgtcgatcgccgcgatcggctg
accgagatcatcgaccgcgccccgcacgaccgtttcgatctctcgccgctcgtgctgttc
tcgtcgtgggaagagctcgatactctgcgcgccgcgccgcccgatccggtcatcgaaggc
gtgatgatcaagcgccgcgacagcgtctaccaggccggccgcatgaaaggcccctggttc
aagtggaagcgcaacccctataatgtcgatgcggtgctgatgtatgcccagcgtggccac
ggcaagcgctccagttactattccgatttcaccttcggcgtctgggccgatgacgaggac
ggcgaacagctggtgcccgtcggcaaggcctatttcggcttcaccgatgccgagctcgag
gtgctcgacaaatttgtgcgcaacaataccaccgagcgtttcggcccggtgcgcgcggtg
cgcgccgacaaggatttcggcttcgtcgtcgaagtggccttcgagggcatcaaccgttcg
acccggcacaaatcgggggtcgccatgcgcttcccccgcatcgcccgccttcgccccgac
aaaccctcctacgaggccgaccggctgcgcacgctgatcgccatgatcgaggccaagccg
gcgtga

DBGET integrated database retrieval system