KEGG   Rhizobium leguminosarum bv. viciae 3841: RL1340Help
Entry
RL1340            CDS       T00402                                 

Gene name
sodA
Definition
(GenBank) putative superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Brite
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RL1340 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAK06837
GeneDB: RL1340
RhizoBase: RL1340
UniProt: Q1MJM3
LinkDB All DBs
Position
1403712..1404314
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS
FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFTSDLGGYDKFKADFATAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDYVLERYEAATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcctgaacttccctatgattacgaagcgcttgctcccttcatgtcg
aaggaaacgctggagttccaccacgacaagcaccacaaggcctatgtcgacaacggcaac
aagctcgccgccgaagccggtctttcggacctgtcgctcgaagacgtcgtcaagaagtcc
ttcggcaccaatgccggcctcttcaacaacgcggcccagcactacaaccacatccatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccgggcaagctcgaagcggcc
tttacctccgatctcggcggctacgacaagttcaaggccgatttcgccactgccggcgcc
acccagttcggctccggctgggcctgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctcgttcacggcgccaccccgatcctcggcgtcgac
gtctgggaacactcctattacatcgactatcgcaacgcccgcccgaaatatctcgaggcc
ttcgtcgacagcctgatcaactgggactacgtcctggaacgctacgaagcagccacgaag
taa

DBGET integrated database retrieval system