KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL110307Help
Entry
pRL110307         CDS       T00402                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    pRL110307
Enzymes [BR:rle01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     pRL110307
Transporters [BR:rle02000]
 Other Transporters
  Pores ion channels [TC:1]
   pRL110307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
pRL11:complement(341095..341820)
Genome map
AA seq 241 aa AA seqDB search
MAYELYYWDGIQGRGEFVRLALEEAGADYIDVTRQPGRGTGAMIDIMESESEPHIPFAPP
FLKDGDLIIPHVANILFYLGPKLGLAPKDEGLRHVVNGLQLTVTDFVAEVHDTHHPIDMS
LYYEDQKQEAKARSAAFIRDRIPKFLGYFERVLRRNPKGANHMVGDALTYVDLSLFQVIE
GLNYAFPKAMTKRKAEYPGLLALHDAVAKRPKIARYLASPRRLAFNEGGIFRHYPELDGV
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgagctttattattgggacggcattcaaggccgcggcgaattcgtgcggttg
gcgctggaagaagccggcgccgattatatcgatgttacccgccagcccgggcgtggcacc
ggtgccatgatcgacatcatggagagcgaaagcgaaccgcatattcctttcgcaccaccc
ttcttgaaggacggcgacctcattatcccgcatgtcgccaacatcctgttttatctcggt
ccgaagctcggccttgcgcctaaggatgaaggccttcgccatgtcgtcaacggcctgcaa
ctgaccgtcaccgatttcgtcgccgaagtgcacgatacgcatcacccgatcgacatgtcg
ctctactacgaggatcagaagcaagaggcaaaagcccgctcggccgctttcattcgtgac
cgcattccaaaattcctcggctatttcgagcgggtgctgcgacgtaacccgaaaggcgcc
aaccatatggtcggcgatgcgctcacctatgtcgacctctcgctcttccaggtgatcgag
ggcctgaattacgcatttccgaaagccatgacgaagcgcaaggcggaatatcccggcctc
ttggctctgcacgatgcggtggcgaagcgaccgaagattgcccgctatctcgcctccccc
cgccgcctcgccttcaacgagggagggattttcaggcattatcctgagctcgacggtgtg
ggctga

DBGET integrated database retrieval system