KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2115Help
Entry
Rleg_2115         CDS       T00926                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rleg_2115
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Rleg_2115
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Rleg_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2105623..2107284
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVETFMDANGDGVGDFQGLMRRLDYLSGLGVTAIWLMPFQASPGR
DDGYDVSDYYNVDPRYGSLGDFVEFTHGAKQRGIRVLIDLVINHTSKDHPWFQDARSDPR
SRYRDWYVWSERKPDNADQGMVFPGVQKTTWTYDDRAKAYYFHRFYDHQPDLNTSNPEVQ
AEILKIMGFWIQLGVSGFRMDAAPFIIATKGADVTKPVEQFDMLRKFREFLQWRLGDSII
LAEANILPKDNFEYFGDDGDRMQMMFNFQVNQALFYAFASADTRPLKKAMEATKPRPATA
QWGLFLRNHDELDLGRLTEKQRAAVFAAFGPEKDMQLYDRGIRRRLAPMLGGDHRRIEMA
YSLLFSLPGTPVIRYGDEIGMGDDLGLPERNCARTPMQWSTEPEGGFTKSEKPISPVIKD
GPYGFQHVNVAEQRRDPNSLLNWTERMIRMRKEAPEIGWGDFSVIDTGDDGVLALRYDWR
GNSVLILHNLHAQPAEVTFDPEIGEDGRQLIDIADGASSKADEKGFHTVMLDAYGYRWYR
VGGLDYLLRRTEI
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctctggtataagaacgctgtcatttactgcctgtccgtcgagaccttc
atggatgcgaacggtgacggcgtcggtgattttcagggtctgatgcggcgcctcgattat
ctctccggcctcggcgtgacggcgatctggctcatgccgttccaggcatcgcccggtcgc
gacgacggttatgacgtctccgattattacaatgtcgatccgcgttatggttcgctcggc
gatttcgtcgaattcacccacggcgccaagcagcgcggtatccgggtactgatcgatctg
gtgatcaatcatacatccaaagaccatccctggttccaggacgccaggagcgatccgcgt
tcgcgctatcgcgactggtacgtctggtcggagagaaaacctgataatgccgatcagggc
atggtcttccccggcgtccagaagaccacttggacctatgacgatagagccaaggcctat
tactttcaccgcttctacgatcaccagcccgatctcaatacatcgaaccccgaggtgcag
gcagaaatcctgaagatcatgggcttctggatccagctcggcgtctccggcttccgaatg
gatgccgcccccttcatcatcgcaacgaaaggcgccgacgttaccaagcctgtcgaacag
ttcgatatgctgaggaaatttcgcgaattcctgcagtggcggctgggcgattccatcatc
ctggcagaggccaacatcctgccgaaggacaatttcgaatatttcggcgatgacggcgac
cgcatgcagatgatgttcaatttccaggtcaatcaagcgctattttatgctttcgccagc
gccgatacccggccgctcaagaaggccatggaggccaccaaaccgcgccctgcgaccgcg
caatggggcctctttctccgcaaccatgatgaactggatctcggccggctgacggaaaaa
caacgcgccgcggtatttgccgccttcgggcctgaaaaggacatgcagctttacgacagg
ggcattcgccgtcgcctcgcgcccatgctcggcggcgaccaccgcaggatcgaaatggcc
tacagcctgctgttttcactgcctggaacgcccgtcatccgatacggcgacgaaatcggc
atgggcgacgatctaggcctgcccgagcgcaattgcgcacgcacgccgatgcagtggtcg
accgaaccggaaggcgggttcaccaaaagtgaaaagccgatctcgcccgttatcaaggac
ggtccctacggtttccagcatgtcaatgttgccgaacagcggcgcgatcccaattctttg
ctgaactggaccgagcggatgatccggatgcgcaaggaagcccctgagatcggctggggc
gacttttctgtaatcgacaccggggatgacggcgtgctggcgcttcgttatgactggcgc
ggcaattccgtgttgatcctgcacaatctgcatgcgcagccggcggaagtgaccttcgat
cccgagataggcgaagacgggcggcaattaatcgatatcgccgatggcgcgagcagcaaa
gcggacgaaaaaggatttcataccgtcatgctcgatgcctacggctatcgctggtatcgc
gtcggcggtctcgattatctcctcaggcggacggagatttag

DBGET integrated database retrieval system