KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_10485Help
Entry
RLEG12_10485      CDS       T03015                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
rlu00473  D-Alanine metabolism
rlu01100  Metabolic pathways
rlu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RLEG12_10485
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RLEG12_10485
Enzymes [BR:rlu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RLEG12_10485
Peptidoglycan biosynthesis and degradation proteins [BR:rlu01011]
 Precursor biosynthesis
  Racemase
   RLEG12_10485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHG49364
LinkDB All DBs
Position
unnamed:1392448..1393587
Genome map
AA seq 379 aa AA seqDB search
MDMDSDILVSRTRTITTAQGATGYLRIDLAALGRNYRKLVSMLTPVRAGAVVKADAYGLG
AERVASTLYGEGCRHFFVAQFVEAVRLRPTLANDAQIFVLNGLQPGNEIACAERGIVPVL
NSLAQWRQWSATARMLKRCLPAVLQFDTGMSRLGFPREERAELAAALGDGSKVEILFIMS
HLASADDMESDQNGEQCAEMSCIADEFPGFDLSFANSGAVFLGDAYHGVLARPGIALYGG
APNAGANNPMEPVVSLTVAVVQTRTVPAGTKVGYGGAYVTQREMRLATIAAGYADGLPRS
LGDRGAVYFNGTRLPIVGRVSMDSVTVDVSALPEGALTLGSLVEVLGPSQTLEDIARDAA
TISYEILTGLGDRYDRQYR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggatatggacagcgatattttggtttcccggacacgcaccatcacgaccgcgcagggc
gccaccggctatctgaggatcgatcttgccgcgctcggccgcaactaccgcaagctcgta
tcgatgctgacgccggtccgcgcgggggccgtcgtcaaggcagacgcctacggcctcggc
gccgagcgggtcgcctcaacgctctacggtgaaggctgccggcatttcttcgtcgcccag
ttcgtcgaggccgtcaggctgcggccgacccttgcgaacgacgcccagattttcgtgctg
aacggcttgcagccgggcaatgagatcgcctgcgccgagaggggcatcgtcccggttctc
aactcgctggcccagtggcggcagtggtcggcgacggcgcgcatgctgaagcgctgcctg
cctgccgtcctgcaattcgacaccggcatgtcgcggctcggctttccccgcgaagaacga
gccgaactggcggcagcgcttggcgacggcagcaaggtcgaaatactgttcatcatgagc
catctggcctcggccgacgatatggagagcgaccagaacggcgagcaatgtgccgaaatg
tcctgcatcgccgacgagttcccgggcttcgacctgtccttcgccaattccggagcggtc
tttctcggcgacgcctatcacggcgtgcttgcccgccccggcatcgcgctttacggcggt
gcgccgaacgccggcgcgaacaacccgatggagccggtcgtcagcctcaccgtcgccgtc
gtgcagacccgcaccgtgccggcaggcacgaaagtcggctatggcggcgcgtatgtcacg
cagcgagaaatgcgtctcgcgacgatcgccgcaggctatgccgacggtctgcccagatcg
ctcggcgaccgtggcgccgtctatttcaacggcacccggctgccgatcgtcggccgcgtc
tcgatggacagcgtgaccgtcgacgtgtcggcgctacccgaaggcgccctgacgctgggt
agtctggtcgaagtgctcggccccagccagacgctcgaggacatcgcccgcgatgccgcc
accatatcttacgaaatcctaaccggtctgggcgatcgttacgacaggcaatatcgctga

DBGET integrated database retrieval system