KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_16415Help
Entry
RLEG12_16415      CDS       T03015                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Brite
Enzymes [BR:rlu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RLEG12_16415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHG44716
LinkDB All DBs
Position
1015906..1016421
Genome map
AA seq 171 aa AA seqDB search
MKAMCTIAALSLLAVVLPAGAQDKQTAVANFVGKDGKEDGRAQLTAAASGGVLIEVEISG
LPANKWVAFHVHETGRCDAATHHESAGGHFNPEKAEHGILAAKGPHAGDLPNQYVGQDGI
LRAQVFDSMVTLDGKTDGIRGRALMVHANSDDYRSQPSGDAGERLSCGVIQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgtgcaccatcgccgccctgagcctgcttgccgttgtattgccggcaggt
gctcaggacaagcagacggcggtcgccaatttcgtcggcaaggacggcaaggaagacggc
cgcgcgcagctgacggctgccgccagcggcggtgtcctgatcgaggtcgaaatatcgggg
ctgccggcaaacaaatgggtcgccttccatgttcatgagaccggccgctgcgacgccgca
acccaccacgagtcggccggcggtcacttcaatcctgagaaggccgagcacggcatcctg
gcggccaagggtccacacgccggcgatctgcccaatcaatatgtcgggcaggacggcatt
ctcagggcgcaggtcttcgacagcatggtcacgctcgacggcaagaccgacggcattcgc
ggccgcgcattgatggtgcacgccaattcggatgattatcgcagccagccttcgggtgat
gccggggaaagactgtcctgcggcgtcattcaatag

DBGET integrated database retrieval system