KEGG   Cupriavidus metallidurans: Rmet_1500Help
Entry
Rmet_1500         CDS       T00351                                 

Gene name
cbbS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase, RuBisCO (type I) small subunit (CbbS)
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rme  Cupriavidus metallidurans
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rmet_1500 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rmet_1500 (cbbS)
Enzymes [BR:rme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rmet_1500 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1620012..1620368)
Genome map
AA seq 118 aa AA seqDB search
MSDVMDYNSRLSDPASRKFETFSYLPAMDAASIKRQVEYLVKKGWNPAIEHIEPEYLMDS
YWYMWKLPMFGETDVDRVLAEAKACHKANPNNHVRLVGYDNFKQSQGAAMVVYRGKTV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgtaatggattacaactcccgcctttccgaccccgccagccggaagttcgaa
actttttcctacctgcccgcgatggacgcggccagcatcaagaggcaggtcgagtatctg
gtgaagaagggctggaacccggctatcgagcatatcgagcctgagtacctgatggactcc
tactggtacatgtggaagttgccgatgttcggtgaaaccgacgtcgatcgcgttctggcc
gaggccaaagcctgccacaaggccaaccccaacaaccacgtgcgcctggtcggctacgac
aacttcaagcagtcgcaaggcgcggccatggtggtttaccgcggcaagacggtttaa

DBGET integrated database retrieval system