KEGG   Cupriavidus metallidurans: Rmet_2750Help
Entry
Rmet_2750         CDS       T00351                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rme  Cupriavidus metallidurans
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rmet_2750 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rmet_2750 (ppc)
   00680 Methane metabolism
    Rmet_2750 (ppc)
Enzymes [BR:rme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rmet_2750 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2986977..2990006
Genome map
AA seq 1009 aa AA seqDB search
MTQPAARPTGRSRSTGRKSVTPASGQLDPEGASPKTPKATKPRTKAAARPKLAVVAAKGA
APTAAATTIPARRTADKDLPLREDIRFLGRLLGDCVREQEGDAAFDLVETIRQTAVRFRR
ENDRAAGTELDRLLKRLSRDQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQP
GSLSRALQAIDAAGVTGKQLREFLDDALIMPVLTAHPTEVQRKSILDAEREIARLLAERD
LPMTTRERDHNTAQLRARVTTLWQTRMLRNTRLMVVDEIENALSYYRTTFLQGIPRLMAE
LEEDIAEVFPRRSKTGATPAPLAPFLQMGSWIGGDRDGNPNVTAETLEHAARQQATLLFD
WYLDELHALGAELPLSSLMVDASPELLALAEASPDHSEHRADEPYRRALIGMYARLAATS
QLLTGHVAQRHPVADVAPYENAEAFAADVQIVVDSLRTHHGEALARGRVDALVRAIAVFG
FHLASIDMRQVSDVHEAVIAELFATAGIESDYAALPEARKLELLLAELRQPRLLTLPWHD
YSEQTRSELAIFAMARDLRARYGARIARNYIISHTETLSDLIEVMLLQKEAGMLRGTLGS
KTDPARMELMVIPLFETIEDLRNAAGIMESLLDLPGFDSVIAHHGVEQEVMLGYSDSNKD
GGFLTSNWELYKAELALVKLFEERRVKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQ
IRLTEQGEIINSKFANAEIGRRNLETVIAATLEASLLPTQNAPKDLATFEGVMQQLSDHA
FSAYRDLVYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRRIEDLRAIPWGFS
WGQCRLLLPGWFGFGSAVQALLDAAPDEKSRKATVATLKRMVKSWPFFSTLLSNMDMVLA
KTDLAVASRYAGLCEDTALRKAVFSRISAEWHLTSDMLGLITGRQERLADNPLLARSIKN
RFAYLDPLNHLQVELLKRYRAGKDGDDVRVRRGIHLTINGVAAGLRNSG
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcctgctgcgcgccccaccggccgttcacgctctaccggccgcaagtctgtt
acgccagcctcaggccagcttgaccccgaaggcgcatcccccaagaccccgaaagccacg
aaaccccgcaccaaagcggcagccaggccaaagctcgctgtcgtggccgccaagggcgcc
gccccaaccgccgcggccaccactatccccgcccgccgcaccgccgacaaggacctgccg
ctgcgcgaggacatccgcttcctcggccgcctgctgggcgactgcgtgcgcgagcaggaa
ggcgatgccgcgttcgacctggtcgagacgattcgccagaccgcagtgcgcttccggcgc
gagaacgaccgcgccgccggcaccgaactcgaccgcctgctgaaacgcctgtcgcgcgac
cagaccaattcggtggtgcgcgccttcagctacttctcgcatctggccaatatcgccgaa
gaccagcaccacaaccgccgccgccgggtgcacgcactggccggatcgccgccgcagccg
ggcagtctgtcgcgcgcgctgcaggccattgacgccgccggcgtgactggcaagcaactt
cgcgaattccttgacgacgcgctgatcatgccggtgctgaccgcgcacccgaccgaagtc
cagcgcaagagcatcctggacgcggagcgcgagatcgcgcgcctgctggccgagcgcgac
ctgccaatgaccacccgcgagcgcgaccacaacacggcccagctccgcgcacgcgtgacc
acgctgtggcagacccgcatgttgcggaacacgcgcttgatggtggtcgatgaaatcgag
aacgcgctctcgtactaccgcaccacgttcctccagggaattccgcgcctgatggccgag
ctggaggaagacatcgccgaagtcttcccgcgccgttccaagaccggcgccacgcccgcg
ccgctggcgccgttcctgcagatgggctcgtggatcggcggcgaccgcgacggcaacccc
aacgtcacggccgaaaccctcgagcacgcggcgcgccagcaagccaccctgctgttcgac
tggtacctcgatgaactgcacgcgctgggcgccgagctgccgctgtcgtcgctgatggtc
gatgccagccccgaactgctggcgctggccgaagcctcaccggaccactccgaacaccgt
gcggacgaaccctaccgccgcgcgctgatcggtatgtacgcgcgcctggccgccacctcg
cagttgctgactggccatgtcgcgcaacgccatccggtggccgacgtcgccccctatgag
aacgccgaagcattcgcggccgacgtgcagatcgtggtcgattcgctacgcacccatcat
ggtgaggcgttggcgcgcggccgcgtcgacgcgctggtgcgcgcgatcgcggtcttcggc
ttccacctggcctcgatcgacatgcgtcaggtatctgacgtgcacgaggccgtgatcgcc
gaactgttcgcgacggccggcatcgagtccgactacgctgcgctgccggaagcacgcaag
ctggagctgctgctggctgaactgcgccagccgcgcctgctgacgctgccgtggcacgac
tactcggaacagacacgcagcgaactggcgatcttcgcgatggcccgcgacctgcgcgcc
cgctatggcgcccgcatcgcgcgcaactacatcatctcgcacaccgagacgctgtccgac
cttatcgaggtgatgctgctgcagaaggaagccggcatgttgcgcggcacgctgggcagc
aagaccgatccggcgcgcatggagctgatggtcatcccgctgttcgaaaccatcgaggat
ttgcgcaatgcggccggcatcatggagtcgctgctggatctgccgggcttcgattcggtg
atcgcccaccatggcgtcgagcaggaagtgatgctcggctattcggattcgaacaaggat
ggcggtttcctgacgtcgaactgggagctctacaaggccgaactggcgctggtgaagctg
ttcgaggaacgccgtgtgaagctgcgcctgttccatggccggggcggcacggtgggtcgc
ggcggtggcccgacctatcaggccatcctgtcgcagccacccggcaccgtgaacggccag
atccgcctgacggaacagggcgaaatcatcaacagcaagttcgcgaatgccgagatcggc
cggcgcaacctggaaacggtgatcgctgccacgctggaagcatcgctgctgcccacccag
aacgcgccgaaggacctggcgacgttcgaaggcgtcatgcaacagctgtccgaccatgcg
ttctccgcgtaccgtgacctggtctacgagaccccgggcttcaaggactacttcttcgcc
acgaccccgatcaccgagatcgcggacctgaacctcggatcgcggccggcatcgcgcaag
ctgatggacaagaagcaccgccgcatcgaagacctgcgggcgattccatggggcttctcg
tggggccagtgccgtctgctgctgccgggctggttcggtttcggcagtgccgtgcaggcc
ctgctggacgccgcgccggacgagaagtcgcgcaaggccacggtggccacgctgaagcgg
atggtgaagtcgtggccgttcttcagcacgctgctatcgaacatggatatggtgctggcc
aagaccgacctggccgtggcgtcacgctacgcggggctgtgcgaggacaccgcgctgcgc
aaggccgtgttctcacgcatcagtgccgaatggcacctgaccagtgacatgctcggactg
atcaccggccggcaggaacgactggctgacaacccgctgctggcgcgctcgatcaagaac
cgctttgcctacctggatccgctgaaccacctgcaggtggaactgctcaagcggtaccgg
gccggcaaggatggcgacgacgtgcgcgtgcgacgcgggatccacctgacgatcaacggg
gtggcggccgggttgcgtaatagcggttga

DBGET integrated database retrieval system