KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2620Help
Entry
Rhom172_2620      CDS       T01606                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rhom172_2620
Enzymes [BR:rmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Rhom172_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2998210..2999025
Genome map
AA seq 271 aa AA seqDB search
MPADHLWHGAIMHRKISDPILMAVCYKDSGSQATPYFNMEKTRGEAYLTGAVQPADELMP
MEPLILRHGGSVGWIEVICGSMFSGKTEELIRRLRRAQIARQRVEVFKPRMDRRYSETDV
VSHDENALRSTPVDSAEQILLLAGSADVVGIDEAQFFDMTLVDVCQQLANDGKRVIVAGL
DQDYMGRPFEPMPQLMAVAEYVTKLHAICAVCGAPANHSQRLTDEEGRVVLGAADRYEPR
CRRCFQPPRPTSASSLKAVAPAATAPRPELP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggatcatctctggcatggcgccatcatgcaccggaaaatcagcgatcccata
ttaatggctgtatgctacaaagacagcgggagtcaggcaacaccctatttcaacatggaa
aaaacgcgaggcgaggcgtatcttaccggagcagtccaacccgcggacgaactcatgccc
atggaacccctgattctgcggcacggcggatcggtcggctggatcgaggtgatctgcggc
tcgatgttcagcggcaagaccgaggagttgatccgtcggctgcgccgggcgcagatcgcc
cgccagcgcgtggaggtcttcaagccccgcatggaccggcgctacagcgaaacggacgtc
gtctcacacgacgaaaacgcgctgcgctcgacgccggtcgacagcgccgagcagatcctg
ctgctggccggatcggccgacgtggtgggcattgacgaggctcagtttttcgacatgacg
ctggtggacgtgtgccagcaactggccaacgacggcaaacgggtaatcgtggccggtctg
gaccaggactacatgggtcggccgttcgagcccatgccccagctcatggccgtggccgag
tacgtgacaaagctgcatgccatctgcgccgtctgcggcgcgccggccaaccactcgcaa
cggctgaccgacgaagaaggacgggtcgtgctcggggcggccgaccgctacgaaccccgc
tgccgtcgctgctttcaaccgccccgcccgacctccgcgtcgtcgctcaaagcggtggct
ccggcggcgacggcgccccgccccgagcttccgtaa

DBGET integrated database retrieval system