KEGG   Ralstonia mannitolilytica: TK49_15075Help
Entry
TK49_15075        CDS       T03778                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rmn  Ralstonia mannitolilytica
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rmn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TK49_15075
  Energy metabolism
   00680 Methane metabolism
    TK49_15075
Enzymes [BR:rmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TK49_15075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3197748..3200759
Genome map
AA seq 1003 aa AA seqDB search
MTQPAARRASSRATPARKASAAPAKPAKATRAAKAATPPVAKANGVDQANGTSLGAPSFG
PVARRSSGSAAAKDQPLKEDIRFLGRLLGDVLREQEGAAAFETVETIRQTAVRFRRDGDR
QAEQDLDRLLKTLSREQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPGSLM
RALLSVADEGVSGETLRRFFDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDTPLT
TRERERNTTLLRAHVTKLWQTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEED
LATVFPRRGARGAPAPLPAFFQMGSWIGGDRDGNPFVTAETLRYAARKQASVILAWYLEE
IHALGAELSMSTSQVDVSAELLALAEQSPDRSEHRADEPYRRALIGVYARLAATCRELTG
EDAGRHAVGPAPAYASAEELRADIQTVIDSLAAHHGEALADARLSSLARAIDVFGFHLSS
IDLRQVSDVHEATVAELLKVAGVESAYAALSEAEKRTLLLRELQQPRLLTLPFHTYSEQT
TSELDIFRAAREVRARYGNRIVRNYIISHTETLSDLLEVMLLQKEAGMFRTGAEGAGAGL
DVMVIPLFETIEDLRNAPEIMGELLALPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSN
WELYKAELALVELFERKGVRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQG
EIISSKFANPEIGRRNLETIVAATLEATLLPTRNRPKGLEEFEAAMQALSDNAFAAYRNL
VYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRRIEDLRAIPWGFSWGQCRLL
LPGWFGFGSAVQQWLDAAGSARARAARLATLKRMYKQWPFFANLLSNMDMVLSKADLNVA
SRYAQLCEDRKLRNAVFSRISAEFTLTEQMLAAITGQSERLADNPLLARSIKNRFPYLDP
LNHLQVELLKRFRSGKAGSDDARVRRGIHLSINGIAAGLRNSG
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcccgccgcgcgccgcgcttcctcgcgcgcgacccccgcccgcaaggcatcc
gccgcccccgccaagccggccaaggccaccagggcggccaaagccgcgacaccgccggtg
gccaaggccaatggcgtggaccaggccaacggcacatcactcggtgcgccatcgttcggg
ccagtcgcacggcgctcgtctggcagtgcggcggccaaggaccagccgctcaaggaagac
atccgcttcctcggccgcctgctgggcgatgtgctgcgcgaacaggaaggcgccgccgcc
ttcgaaaccgtcgagaccatccgccagaccgccgtacgctttcgccgcgatggcgaccgc
caggccgagcaggatctcgaccgcctgctcaagacgctctcgcgcgagcagacgaactcc
gtggtgcgcgcgttcagctatttctcgcacctggccaacattgccgaagaccagcaccac
aaccgccgccgccgcgtgcatgcgctggccggctcgccgccgcagccgggcagcctgatg
cgggcgctgctgtcggtggccgatgaaggggtgtctggcgagacgctgcgccggttcttt
gatgccgcgctgatcgtgccggtgctcactgcgcacccgaccgaggtgcagcgcaagagc
attctcgatgcgcagcgcgagattgcgcgcctgctggccgaacgggacacgccgctcacg
acgcgcgagcgcgaacgcaacacgacgctgctgcgcgcgcacgtgaccaagctgtggcag
acgcgcatgctgcgcaccacgcgcctgatggtggccgacgagatcgaaaacgcgctgtcg
tactaccagacgacgttcctgcgcgagattcccgcgctgtaccgcgagctcgaagaggat
ctggcgaccgtcttcccgcgccgcggcgcccgtggcgcgccggctccgctgcccgccttc
ttccagatgggctcgtggatcggcggcgaccgcgacggcaacccgttcgtcacggcagaa
acgctgcgctacgcggcccgcaagcaggcgagcgtgatcctcgcgtggtacctggaagag
atccacgcactgggcgccgagctgtcgatgtcaacgtcgcaggtcgatgtaagcgccgaa
ctgctggcgctggcagagcaatcgcccgaccgctccgagcatcgcgcggacgagccctac
cgccgcgcgctgatcggcgtctacgcccggctggctgccacgtgccgcgagctgactggc
gaagacgcaggccgccatgccgtgggcccggcacccgcctatgccagcgcggaggaactg
cgcgccgacatccagaccgtcatcgattcgctggccgcgcaccacggcgaggcgctggca
gatgcgcgcctgagctcgctggcgcgcgcgatcgatgtgttcggcttccacctgtcttcg
atcgacttgcggcaggtgtcggacgtgcacgaagcgaccgtcgccgaattgctcaaggtc
gcgggcgtggaaagcgcgtacgcggcgctgtccgaagccgagaagcgcacgctgctgctg
cgcgagctgcaacagccgcgcctgctgacgctgccgttccatacgtacagcgagcagacc
acgtcggagctcgacatcttccgtgccgcgcgcgaggtgcgggcccgctacggcaaccgc
atcgtgcgcaactacatcatctcgcacaccgagacgctgtccgacctgctcgaagtgatg
ctgctgcagaaggaagccggcatgttccgcacgggcgccgagggtgcaggcgcagggctg
gacgtgatggtgatcccgctgttcgaaaccattgaagacttgcgcaacgccccggagatc
atgggcgagctgctagccctgcccggcttcgatgccgtgctggccgcgcagggcaacgag
caggaggtcatgctcggctattccgactccaacaaggacggcggtttcctcacctccaac
tgggagctgtacaaggccgagctggcactggtggagctgttcgagcgcaagggcgtgcgc
ctgcgcctgttccacggccgcggcggcacggtgggccgaggcggcggcccgacctaccag
gccatcctgtcgcagccgccgggcaccgtgaacggtcagatccgcctgaccgaacagggc
gaaatcatctccagcaagttcgccaaccccgagatcggccggcgcaacctggagaccatc
gtcgccgccacgctggaagcgacgctgctgcctacgcgcaaccgccccaagggcctggaa
gagttcgaagccgccatgcaggcgctgtcggacaacgcctttgccgcataccggaacctc
gtctacgaaacgccgggcttcaaggactacttcttcgccaccacgcccatcaccgagatt
gccgacctgaacctcggttcgcgcccggcctcgcgcaagctgatggacaagaagcatcgt
cgcatcgaagacctgcgcgcgattccgtggggcttctcgtggggccagtgccgcctgctg
ctgccgggctggttcggctttggcagcgccgtgcagcagtggctggacgccgccggcagc
gcccgggcccgcgcggcacgcctggccacgctcaagcgcatgtacaagcagtggccgttc
tttgcgaacctgctgtcgaacatggacatggtgttgtccaaggcggacctcaacgtggcc
tcgcgttatgcgcagctgtgcgaggaccgcaagctgcgcaacgcggtgttctcgcgcatc
tcggcggagttcacgttgaccgagcagatgctggccgccatcacggggcaatcggagcgc
ctggccgacaacccgctgctcgcgcgctccatcaaaaaccgcttcccctacctggacccg
ctgaaccacttgcaggtcgaactgctcaagcggttccgctcgggcaaggccggcagcgac
gatgcacgcgtgcgccgcggcatccacctgtcgatcaacgggatcgcggccgggctgcgc
aatagcggctga

DBGET integrated database retrieval system