KEGG   Rattus norvegicus (rat): 100364027Help
Entry
100364027         CDS       T01003                                 

Definition
(RefSeq) hexokinase 1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100364027
   00051 Fructose and mannose metabolism
    100364027
   00052 Galactose metabolism
    100364027
   00500 Starch and sucrose metabolism
    100364027
   00520 Amino sugar and nucleotide sugar metabolism
    100364027
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100364027
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100364027
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100364027
  Digestive system
   04973 Carbohydrate digestion and absorption
    100364027
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100364027
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100364027
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100364027
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100364027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
LinkDB All DBs
Position
20q11
AA seq 886 aa AA seqDB search
MFAVHLVAFYFTKLKEDQIKKVDRFLYHMRLSDETLVDIMARFQAEMEKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSEEGKQNVQMESQFYPMPNEITR
GNGTELFDYVADCLADFMKTKDLTHKKLPLGFTFSFPCRQNKLEEGFLLSWTKKFKARGV
QDTDVVNRLATAMKKHKDLDVDILALVNDTVGTMMTCAYDDPNCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YMGELVRLILLKMAKVGLLFGGAKSSALHTKGKIETQHVAAMEMSKEGLANTREILVDLG
LDPSESDCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLARLRTTVGMDGTLYKTH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFHLT
REQLLGVRDKMRAELEYGLKKKTHALATVKMLPTYVYGMPDGTEKGKFLALDLGGTNFRV
LLVKIRKRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFTFS
FPCRQTCIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMM
TCGYEDPRCEIGLIAGTWRLWLAFHTQNSILREHFSALTSLIPSSPNRYEKMTSGMYLGE
IVRRILIDLTRQGLLFRGQISERLRTRGIFETKFLSQIESDRLALLQVRRILQQLGLDST
CEDSIVVKEVCGAVSRRAAQMCGAGMAAIVEKRREDQGLQHFKVTVGVDGTLYKLHPHFS
RILQETVKDLAPQCDVTFMLSEDGSGKGAALITAVAKRLQQLPKDN
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagttcacttagtggcgttttacttcaccaagctgaaagaggaccagatcaag
aaggtggacaggttcctgtaccatatgcggctctcggatgagacccttgtggacatcatg
gcccgattccaggccgagatggagaaaggcttagggaaggacaccaaccccactgcctca
gtgaagatgctgcccacattcgtcagggccattccagatggctcagaaaacggggaattc
ctttccctggatctcggagggtccaagtttcgggtcctgaaggtgcaagtctcggaagag
ggcaagcaaaatgtccagatggagagccagttctacccaatgcccaatgaaatcacccgt
gggaatggcacggagctctttgactatgtagctgactgcctggcagatttcatgaagacc
aaagatctgacgcacaagaagctgcctctgggcttcaccttttcttttccctgcagacag
aataagttggaggagggcttcctgctgtcatggaccaagaagttcaaggcccggggagtt
caggacacagacgtggtgaaccgtctggccaccgccatgaaaaagcacaaggacctggac
gtggacatcctggccttggttaacgacactgtggggaccatgatgacttgtgcttatgat
gatcccaactgtgaggtcggcgttatcattggaacaggcaccaacgcgtgttacatggag
gacatgagcaacatcgaccttgtggaaggggacgagggaaggatgtgcatcaacacggag
tggggggccttcggggacgatggcactttggaggacattcgcaccgagtttgacagagag
ttggacctgggctcactcaaccccgggaagcagctgttcgagaagatgatcagcgggctg
tacatgggggagctggtcaggctcatcttgctgaagatggccaaagttggtctcctgttt
gggggtgcaaagtcctccgctctccacacaaagggcaagattgaaacacagcacgtggct
gccatggagatgagtaaagaaggcctggccaatacgagagagatcctggtggatttgggc
ctggacccctctgagtcagactgcatcgctgtccagcacgtgtgcaccatcgtctctttt
cgctcggccaatctctgcgccgctgcgctggcagccatcttgactcgcctccgagagaac
aagaagctggcccggctccgcaccacggtgggcatggatggaaccctctacaaaacacac
cctcagtaccccaaacgcctacacaaagtggtgaggaggctggtcccaaactgtgatgtc
cgcttcctcctatcagagagcggaagcaccaaaggggctgccatggtgaccgcagtggcc
tctcgggtgcaggcccagcgtaagcagatcgataaggtgctggctttgttccatttgacc
cgagagcaactcctgggtgtgcgggacaagatgcgggctgaacttgagtatgggctgaag
aaaaaaactcacgctctggctacagtgaagatgcttcccacctacgtctatgggatgccc
gatggcacagagaaaggaaagttccttgccctggacttggggggaactaacttccgcgtc
ctccttgtaaagatcaggaagaggtcggtgcgaatgtacaacaagatctttgccatccct
ctggagatcatgcagggcactggagaggagctctttgaccacattgtgcagtgcatcgct
gacttcctggactatatgggcctcaagggcgcccagctgcctttgggcttcacattctcc
ttcccctgcagacaaacatgcatcgacaaggggactctagtaggatggaccaaaggcttc
aaggccaccgactgtgaaggggaggacgtggtggacatgctcagagaagccatcaagagg
agaaacgagtttgacctggacatagttgcaatcgtgaatgacacggtggggaccatgatg
acctgtggctatgaggatccccggtgtgagattggcttgattgcaggtacgtggcgcctg
tggcttgctttccacacccagaacagcatcctcagagagcacttttctgcccttaccagt
cttatcccctcttccccaaacaggtacgagaaaatgaccagtgggatgtacctgggggag
attgtgaggcggatcctgatcgacctcacccggcaggggctcctcttccgagggcagatt
tcagagcgactccggaccaggggtatctttgaaaccaaattcctgtctcagattgaaagt
gaccggctggccctcctgcaggtcaggaggatcctgcagcagctgggcctggacagcacc
tgcgaagacagcattgtggtgaaggaggtgtgcggggctgtgtctcggagggctgcccag
atgtgcggcgccggcatggctgccatcgtggagaaaaggagagaagaccagggcctccag
cacttcaaggtcactgtgggcgtggacggcaccctgtacaagctgcacccacacttctcc
cggatactgcaggagacagtgaaggacctggctcctcagtgcgacgtgactttcatgttg
tcagaagacggcagcgggaagggagcagctctgatcacagctgtagccaagaggttacag
cagctgccgaaggacaactag

DBGET integrated database retrieval system