KEGG   Rattus norvegicus (rat): 103689940Help
Entry
103689940         CDS       T01003                                 

Gene name
Amy2, Amy2-3
Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103689940 (Amy2)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    103689940 (Amy2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103689940 (Amy2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Motif
Other DBs
NCBI-GeneID: 103689940
NCBI-ProteinID: XP_008759670
RGD: 9468847
Ensembl: ENSRNOG00000055613
UniProt: E9PSI7
LinkDB All DBs
Position
2q41
AA seq 508 aa AA seqDB search
MKFVLLLSLIGFCWAQYDPHTADGRTAIVHLFEWRWADIAKECERYLAPKGFGGVQVSPP
NENIIINNPSRPWWERYQPISYKICSRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGS
GNSAGTHSTCGSYFNPNNREFSAVPYSAWDFNDNKCNGEINNYNDANQVRNCRLSGLLDL
ALDKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP
FIFQEVIDLGGEAIKGSEYFGNGRVTEFKFGAKLGTVIRKWNGEKMSYLKNWGEGWGFVP
TDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWTRNF
QNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFAN
WWDNGSNQVAFSRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKVNGNCTGLKVN
VGSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgttctgctgctttccctcattgggttctgctgggctcaatatgacccacac
actgcggatgggaggactgctattgtccacctgttcgagtggcgctgggctgatattgcc
aaggaatgtgagcgatacttagcacctaagggatttggaggggtgcaggtctctccaccc
aatgaaaatattataattaataatccatcaaggccttggtgggaaagatatcaaccaatc
agctacaaaatttgctcaaggtctggaaatgaaaatgaattcaaagacatggtgacgagg
tgcaacaatgttggtgtccggatttatgtggatgctgtcattaatcacatgtgtggctcg
ggcaatagtgcaggaacacacagtacctgtggaagttacttcaatcctaataacagggaa
ttctcagcagttccatactctgcttgggattttaacgataataaatgtaatggagaaatt
aataactacaatgatgccaatcaggtcagaaattgtcgtctgtctggccttctggatctt
gcacttgataaagattatgttcgaaccaaggtggctgactatatgaaccatctcattgac
attggtgtagcagggttcagacttgatgctgctaagcacatgtggcctggagacataaag
gcagtattggacaaactacataatctaaatacaaaatggttctcccaaggaagcagacct
ttcattttccaagaggtcattgatcttggtggtgaggcaattaaaggtagtgagtacttt
ggaaatggtcgcgtgacagaattcaagtttggtgcaaaacttggcacagttatccgcaag
tggaatggagagaagatgtcttatttaaagaactggggagaaggttggggttttgtgcct
actgacagagcccttgtgtttgtggacaaccatgacaatcagcgaggacatggtgctgga
ggagcatccatcctgacattctgggatgctagaatgtataaaatggcagttggatttatg
ttggctcatccttatggattcaccagagtaatgtcaagttaccgatggacaagaaatttc
cagaatggaaaagatgtgaatgactggattggaccacctaataacaatggagtaacaaaa
gaagtgaccattaatccagacactacttgtggcaatgactgggtctgtgaacatcgatgg
cgtcaaatcaggaacatggttgccttcaggaatgtagtcaacggtcagccttttgcaaac
tggtgggataatggcagcaaccaagtggcttttagcagaggaaacagaggattcattgtc
tttaacaatgatgactgggctttgtcaagcactctacagactggtcttcctgctggcaca
tactgtgatgtcatttcaggagataaagtcaatggcaattgcactggacttaaagtaaat
gttggcagtgatggcaaagctcacttctctattagtaactctgctgaagacccattcatt
gcaatccatgccgactcaaagttgtaa

DBGET integrated database retrieval system