KEGG   Rattus norvegicus (rat): 24203Help
Entry
24203             CDS       T01003                                 

Gene name
Amy1a, Amy1
Definition
(RefSeq) amylase, alpha 1A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    24203 (Amy1a)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    24203 (Amy1a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     24203 (Amy1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Motif
Other DBs
NCBI-GeneID: 24203
NCBI-ProteinID: NP_001010970
RGD: 2113
Ensembl: ENSRNOG00000033529
UniProt: Q99N59
LinkDB All DBs
Position
2q41
AA seq 521 aa AA seqDB search
MREYCQHHSRMKFFLLLSLIGLCWAQYDPHTFYGRSSIVHLFEWRWVDIAKECERYLAPN
GFGGVQVSPPNENIVVNSPFRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYV
DAVINHMCGVGAEAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCKTGSGGIENYNDAA
QVRDCRLSGLLDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAVLDKLH
NLNTKWFSEGSKPFIYQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVLRKWDGEKMA
YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAVGFMLAHPYGF
TRVMSSFHWPRYFENGKDVNDWVGPPNNNGATKEVTINSDSTCGNDWVCEHRWRQIRNMV
AFRNVVNGQPFANWWDNGSNQVAFGRGNKGFIVFNNDDWDLSTTLQTGLPAGTYCDVISG
DKVDGNCTGIKVYVGSDGNAYFSISNSAEDPFIAIHVESKI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatactgccaacatcatagcagaatgaaattcttcctgctgctttccctcatt
gggctctgctgggcccaatatgacccacatactttttatggacggtcttctattgtccat
ttgttcgagtggcgctgggttgatattgctaaggagtgtgagcgatatttagctcctaat
ggatttggaggcgtgcaggtttctccacccaatgaaaatattgtggtcaacagtcctttt
agaccatggtgggaaagatatcaaccaattagctacaaaatatgctccaggtctggaaat
gaggatgaattcagagacatggtgaacagatgcaacaacgttggtgtccgtatttatgtg
gatgcggtcattaatcacatgtgtggggttggggctgaagctggacaaagcagtacatgc
ggaagttatttcaacccaaataacagggactttcctggagttccgtattctggtttcgac
tttaatgatgggaaatgtaaaactggaagtggaggcattgagaactacaatgatgctgct
caggtcagagattgtcgtctgtctggccttctggatcttgcacttgagaaagattatgtt
cgtaccaaggtggctgattacatgaaccatctcattgatattggtgtagcagggttcaga
cttgatgcttctaaacacatgtggcctggagacataaaggcagttttggacaaactacat
aatctaaatacaaaatggttctccgaaggaagcaaacctttcatttatcaagaggtcatt
gatctgggtggtgaagcagtgtcaagtaatgagtattttggaaatggccgtgtgacagaa
ttcaaatatggagcaaaactgggcaaagttttgcgcaagtgggatggagaaaagatggcc
tacttaaagaactggggagaaggttggggtttcatgccttctgacagagcccttgtcttt
gtggacaaccatgacaaccagcgaggacatggtgctggaggatcatccatcctgactttc
tgggatgctcgactctataaaatggctgtcggatttatgttggctcatccttatggtttc
actcgggtaatgtcaagtttccattggccaagatatttcgagaatggcaaagatgtcaat
gactgggttggaccacctaataacaatggagcaaccaaagaagtgaccattaactcagac
agcacttgtggcaatgactgggtctgtgaacatcgatggcgtcaaataaggaacatggtt
gccttcaggaatgtggtcaatggtcagccttttgcaaactggtgggataatggcagcaac
caagtagcttttggcagaggaaacaaaggcttcattgtctttaacaatgatgactgggac
ttgtcaacaactctacagactggtcttcctgctggcacatactgtgatgtcatttctgga
gacaaagtcgatggcaattgcactggaataaaagtctatgttggcagtgatggcaatgct
tacttctctattagtaactctgctgaagacccattcattgcaatccatgtagagtcaaaa
atctaa

DBGET integrated database retrieval system