KEGG   Rattus norvegicus (rat): 24379Help
Entry
24379             CDS       T01003                                 

Gene name
Gad1, Gad67
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Type I diabetes mellitus
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    24379 (Gad1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    24379 (Gad1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    24379 (Gad1)
   00430 Taurine and hypotaurine metabolism
    24379 (Gad1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    24379 (Gad1)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    24379 (Gad1)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     24379 (Gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
3q22
AA seq 593 aa AA seqDB search
MASSTPSPATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKS
RLVSAFRERQASKNLLSCENSDPGARFRRTETDFSNLFAQDLLPAKNGEEQTVQFLLEVV
DILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWSN
KDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAAL
GFGTDNVILIKCNERGKIIPADLEAKILDAKQKGFVPLYVNATAGTTVYGAFDPIQEIAD
ICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
GILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQIN
KCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPK
IKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccacgccttcgcctgcaacctcctcgaacgcgggagcggatcctaatact
accaacctgcgtcctacaacatatgatacttggtgtggcgtagcccatggatgcaccaga
aaactgggcctgaagatctgtggtttcttgcaaaggaccaatagcctggaagagaagagt
cgtcttgtgagcgccttcagggagaggcaggcctccaagaacctgctttcctgtgaaaac
agtgaccctggtgcccgcttccggcgcacagagacggacttctccaacctgtttgctcaa
gatctgcttccagctaagaacggggaggagcaaactgtgcagttcttactggaggtggtt
gacatactcctcaactatgtccgcaagacgtttgatcgctccaccaaggttttggacttc
caccacccacaccagttgctggaaggcatggaaggttttaatttggagctgtctgaccac
cccgagtctctggagcagatcctggttgactgtagagacaccctaaagtacggggttcgc
acaggtcaccctcggtttttcaaccagctctctactggtttggatatcattggtttagct
ggcgaatggctgacatcaactgccaataccaatatgttcacatatgaaattgcacccgtg
tttgttcttatggaacagatcacacttaagaagatgcgagagatcattggatggtcaaat
aaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatcatg
gcggctcggtacaagtactttccagaagtgaaaacaaaaggcatggcggctgtgcccaaa
ctggtcctcttcacctcagaacacagtcactattccataaagaaggctggggctgcgctt
ggctttggaactgacaatgtgatcctgataaagtgcaatgaaagggggaagataattcca
gctgatttagaggcaaaaattcttgatgccaaacaaaagggatttgttcccctttatgtc
aatgcaaccgcaggcacgactgtttatggagcgtttgatccgatccaggagattgcagac
atatgtgagaaatacaacctttggctgcatgtggatgctgcctggggtggtgggctgctc
atgtcccggaagcatcgccacaaactcagcggcatagaaagggccaattcagtcacctgg
aaccctcacaagatgatgggtgtgctgctccagtgttctgccatcctggtcaaggaaaag
ggtatactccaaggatgcaaccagatgtgtgcaggctacctcttccagccagacaagcag
tatgacgtctcctacgatacaggggacaaggcgattcagtgtggccgccatgtggacatc
ttcaagttctggctgatgtggaaagcaaagggcactgtgggatttgaaaatcagatcaac
aaatgcctggagctggctgaatacctctatgccaagattaaaaacagagaagagtttgag
atggttttcaatggtgagcctgagcacacaaatgtctgtttctggtacataccacaaagc
ctccgaggggttccagacagccctgagcgacgagaaaaactacacagggtggctcccaag
atcaaagccctgatgatggagtcaggaacaaccatggttggttaccagcctcaaggggac
aaggccaacttcttccggatggtcatctccaacccagccgccacccagtctgacatcgat
ttcctcatcgaggaaatagagaggttgggtcaagatctgtaa

DBGET integrated database retrieval system