KEGG   Rattus norvegicus (rat): 24693Help
Entry
24693             CDS       T01003                                 

Gene name
Ptgs1, Cox-1, Cox-3, Cox1, Cox3, Pghs-1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04611  Platelet activation
rno04726  Serotonergic synapse
rno04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    24693 (Ptgs1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    24693 (Ptgs1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    24693 (Ptgs1)
  Nervous system
   04726 Serotonergic synapse
    24693 (Ptgs1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     24693 (Ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 24693
NCBI-ProteinID: NP_058739
RGD: 3439
Ensembl: ENSRNOG00000007415
UniProt: Q66HK3
LinkDB All DBs
Position
3p11
AA seq 602 aa AA seqDB search
MSRRSLSLQFPLLLLLLLLPPPPVLLTDAGVPSPVNPCCYYPCQNQGVCVRFGLDHYQCD
CTRTGYSGPNCTIPEIWTWLRSSLRPSPSFTHFLLTHGYWIWEFVNATFIREVLMRLVLT
VRSNLIPSPPTYNTAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDIHLLA
QRLLLRREFIPAPQGTNVLFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDSL
ERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPEKQMAVGQEVFGLLPGL
MLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIIIEEYVQHLSGYFLQ
LKFDPELLFRAQFQYRNRIALEFNHLYHWHPLMPDSFQVGSQEYSYEQFLFNTSMLVDYG
VEALVDAFSRQRAGRIGGGRNFDYHVLHVAEDVIKESREMRLQSFNEYRKRFGLKPYTSF
QEFTGEKEMAAELEELYGDIDALEFYPGLMLEKCQPNSLFGESMIEMGAPFSLKGLLGNP
ICSPEYWKPSTFGGDVGFNIVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVFVRPST
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaaggagtctctcgctccagtttcccctgctgctgctcctgctgctgctccca
ccacccccggtactgctcacagatgctggggtaccctcaccagtcaatccctgttgttac
tatccatgccagaaccagggtgtctgtgtccgcttcggcctcgaccactaccaatgtgac
tgtactcgcacgggctactcgggccccaactgtactatccctgagatctggacctggctt
cggagttccctgcggcccagcccctcattcacccatttcctgctgacacacgggtactgg
atctgggagtttgtgaatgccaccttcatccgagaagtactcatgcgcctggtactcacg
gtgcggtccaaccttatccccagccctccaacctacaacacagcacatgactacatcagc
tgggagtccttctccaacgtgagctactatactcgcattctgccctctgtacccaaagac
tgtcccacacccatgggaaccaaagggaagaagcagttaccagatattcatcttctggcc
caacgattgctgctgagaagggagttcattcccgccccgcaggggaccaacgtcttgttt
gctttctttgcacaacacttcacccaccagttcttcaagacctctggaaagatgggtcct
ggctttaccaaggccttaggccatggggtagaccttggccacatttatggagatagtctg
gaacgacagtaccacctgcggctcttcaaggatgggaaacttaagtaccaggtgctggat
ggagaggtgtacccaccttccgtagaacaggcgtccgtgttgatgcgctacccaccaggt
gtcccgcccgaaaagcagatggctgtgggccaggaggtgtttgggttgctcccgggtctg
atgctcttctccacgatctggctgcgcgagcataaccgtgtgtgtgacttgctgaaggag
gagcatcctacatgggatgacgagcagctcttccagaccactcgcctcatccttataggg
gaaaccatcaagattatcatcgaggagtacgtacagcacttgagtggctatttcctgcag
ctcaagtttgacccggagctgctgttccgagcccagttccagtatcgcaaccgcatcgcc
ttggaattcaaccacctctatcactggcatccgctcatgcctgattccttccaagtgggc
tcacaagagtacagctatgagcagtttttatttaacacatctatgctggtggactacggt
gtcgaggcactggtggatgccttctctcgccagagggctggccggattggtgggggtagg
aactttgactaccatgttctgcatgtggccgaggatgtcatcaaggagtcccgagaaatg
cgcctgcagtccttcaatgaataccgaaagaggtttggcctgaagccttacacttctttc
caggagttcacaggagagaaggagatggccgctgagttggaggagctatatggtgacatc
gatgctttagagttctacccggggctgatgctggagaagtgccagcccaactccctcttt
ggggagagcatgatagagatgggggctcctttctccctcaagggcctcctagggaatccc
atctgttccccagagtactggaaacccagcacattcggtggtgatgtgggtttcaacatc
gttaacacagcctcactgaagaaactggtctgcctcaacaccaagacctgcccctatgtc
tccttccgtgtgccagattaccctggagatgacgggtctgtcttcgtgagaccttccact
gagctctga

DBGET integrated database retrieval system