KEGG   Rattus norvegicus (rat): 286911Help
Entry
286911            CDS       T01003                                 

Gene name
Prss3, Try3
Definition
(RefSeq) protease, serine, 3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04972  Pancreatic secretion
rno04974  Protein digestion and absorption
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    286911 (Prss3)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    286911 (Prss3)
   04974 Protein digestion and absorption
    286911 (Prss3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    286911 (Prss3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     286911 (Prss3)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   286911 (Prss3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   286911 (Prss3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 286911
NCBI-ProteinID: NP_775150
RGD: 708437
Ensembl: ENSRNOG00000013382
UniProt: P08426
LinkDB All DBs
Position
4q23
AA seq 247 aa AA seqDB search
MKALIFLAFLGAAVALPLDDDDDKIVGGYTCQKNSLPYQVSLNAGYHFCGGSLINSQWVV
SAAHCYKSRIQVRLGEHNIDVVEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKLNSPATL
NSRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPGKI
TSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWI
QQTVAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttaattttccttgctttccttggagctgctgttgctctccctctggatgat
gatgatgacaagattgttggaggctacacctgccagaagaattctctcccataccaggtg
tctctgaatgctggctaccatttttgtggaggctccctcatcaattcccagtgggttgtt
tcagccgctcactgctacaaatcccgaattcaggtgcgcctgggagaacacaacattgat
gtcgttgagggtggtgagcaattcattgatgcagctaaaatcatccgccaccccagttat
aatgcaaacacctttgacaatgatattatgttgattaagctgaattcacctgccaccctc
aattctcgagtgtccactgtctctctgccaagatcttgtggatcatctggtactaagtgc
cttgtgtctggctggggcaacaccctgagctctggcacgaactacccttcactgcttcag
tgtcttgatgcccctgtcctctctgacagttcttgcaaaagttcttacccaggcaagatc
actagcaacatgttctgtctgggctttctggagggcggaaaggactcctgccagggtgac
tctggtggccctgtagtctgcaatggccagctccagggtgttgtttcctggggttatggc
tgtgctcagaaaggaaaacctggtgtctataccaaggtatgcaactacgtgaactggatt
cagcagaccgtcgctgccaactaa

DBGET integrated database retrieval system