KEGG   Rattus norvegicus (rat): 29204Help
Entry
29204             CDS       T01003                                 

Gene name
Neu2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    29204 (Neu2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    29204 (Neu2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     29204 (Neu2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
9q35
AA seq 379 aa AA seqDB search
METCPVLQKETLFHTEVYAYRIPALLYLKKQKTLLAFAEKRASRTDEHAELIVLRRGSYN
GATNHVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEQHQLQTRVN
VTRLCRVTSTDYGMNWSPVQDLTETTIGSTHQDWATFAVGPGHCLQLRNRAGSLLVPAYA
YQKLHPVHKPTPFAFCFISLDHGHTWELGNFVSENSLECQVAEVGTGAHRVVYLNARSFI
GARVQAQSPNDGLDFQDNQVVSKLVEPPHGCHGSVVAFHSPTSKPDALDMWLLYTHPTDS
RNRTNLGVYLNQTPLDPTAWSEPTLLATGTCAYSDLQNMGRGPDGSPQFGCLYESGNYDE
IIFLMFTLKQAFPTVHGAQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggagacctgccccgtcctccagaaagagacgctgttccacacagaagtctatgcttac
agaatccctgctctgctctacctgaagaagcagaagaccctgctggcctttgcagaaaag
cgagccagcaggacggatgagcatgctgagttgattgtcctgcgaagagggagctacaat
ggagccaccaaccatgtcaagtggcaacctgaggaagtggtgacccaagcccagctggag
ggccaccgctccatgaatccatgtcccttgtatgacaagcaaacaaagaccctcttcctt
ttcttcattgctgtccctgggcgtgtatcagaacagcatcagctccaaactagggttaat
gtcacacggctatgccgtgtcaccagcaccgattatgggatgaactggagccccgtccag
gacctcacagagaccaccattggcagcacccaccaggactgggccacatttgctgtgggt
ccagggcactgtctgcagctgcggaacagagctgggagcctgctggtacctgcttatgcc
taccagaagctgcaccctgtccataaacctaccccctttgccttctgcttcatcagcctt
gaccacgggcacacgtgggaactagggaactttgtgtctgagaactcactggagtgtcag
gtggctgaggttggcactggtgctcatagggtggtatatctcaatgctaggagcttcata
ggagctagagtccaggcacaaagtcctaacgatggcctggatttccaggacaaccaggta
gtaagtaagcttgtagagcccccccacgggtgtcatggaagtgtggtcgccttccacagc
cccacctctaagccagatgccttagacatgtggctgctttatacccaccctacggactcc
aggaatagaaccaacctgggcgtgtacctcaaccagacgccactagatcccacagcctgg
tcagagcccaccctgctagccacgggcacctgtgcctactcagacttgcagaatatgggg
cgtggccctgatgggtccccacagtttgggtgcctgtatgaatcaggtaactatgacgag
atcattttcctcatgttcaccctgaagcaagcttttcccacagtacatggtgctcagtga

DBGET integrated database retrieval system