KEGG   Rhodococcus opacus PD630: Pd630_LPD01628Help
Entry
Pd630_LPD01628    CDS       T03071                                 

Definition
(GenBank) putative ATP-dependent DNA ligase ykoU
Organism
roa  Rhodococcus opacus PD630
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1714253..1715281
Genome map
AA seq 342 aa AA seqDB search
MASPAEELDVDGVAVRLSNPDKIYYPKLGAEGGTKRHLVEYYRTVALNGALLTALFDRPT
HLQRFPDGIEGEEIYQKRVPAKRPDHVESCEVTFPSGRKADVLRVRSAANIVWAANLGNI
TFHPWAVRCPDVDHPDELRIDLDPQPGTGFDDARAVALDVLRPLLDELGLVGYPKTSGGR
GLHVYLRIEPRWDFIEVRRAGIALAREIERRSGDRATTSWWKEERGERIFLDFNQNARDK
TIASAYSARKTPIATVSTPVTWEELVDVDPDDFTIATVPALLEKRGDPMATMGDVAQSLD
VLLEMAERDAANGLGDLPYPPNYPKMPGEPKRVQPSRDRDRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcctgccgaagaactcgacgtcgacggcgtcgccgttcggctgtcgaatccc
gacaagatctactacccgaaactcggtgccgagggcggcacgaaacggcacctggtggag
tactaccggaccgtggcactgaacggtgcgctgctgaccgccctgttcgatcggccgacg
catctgcaacggttcccggacgggatcgagggcgaggagatctaccagaagcgggttccc
gcgaagcgccccgaccacgtggaatcgtgcgaggtcacgttcccgtccggccgcaaggcc
gacgtgctccgtgtgcgcagcgccgcgaacatcgtgtgggcggcgaacctcggcaacatc
acgttccacccgtgggcggtccggtgccccgacgtcgatcacccggacgaactgcgcatc
gacctggacccgcagccggggaccggattcgacgacgcgcgggcggtcgcgctggacgtg
ctccggccgctgctggacgaactcggtctcgtcggataccccaagacgtcgggcggccgc
gggctgcacgtgtatctccgcatcgaaccgcgctgggatttcatcgaggtgcggcgtgcg
ggcatcgccctcgcacgggagatcgagcggcgcagcggcgaccgggccaccacgtcctgg
tggaaggaggaacgcggcgaacgcatcttcctcgacttcaaccagaacgccagggacaag
accatcgcgtccgcctactcggcccgcaagacgccgatcgcgaccgtgtcgacgccggtc
acctgggaggaactcgtcgacgtcgaccccgacgacttcaccatcgcgaccgtgcccgcg
ctgctcgagaagcgtggcgatcccatggcgaccatgggtgacgtggcgcaatcgctggac
gtgctgctggagatggccgaacgggacgccgcgaacggtctcggggatctgccgtacccc
cccaattaccccaagatgccgggggaacccaagcgggtacaaccgagtcgggaccgagac
cgcaaatag

DBGET integrated database retrieval system