KEGG   Rhodococcus opacus PD630: Pd630_LPD02921Help
Entry
Pd630_LPD02921    CDS       T03071                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00564  Glycerophospholipid metabolism
roa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pd630_LPD02921
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Pd630_LPD02921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N AlaDh_PNT_C Pyr_redox Thi4 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AHK30144
UniProt: W8H584
LinkDB All DBs
Position
3124597..3126321
Genome map
AA seq 574 aa AA seqDB search
MQFLGPRQRDAAWDKLQTEQFDVVVIGGGVVGAGAALDAATRGLKVALVEARDYASGTSS
RSSKMFHGGLRYLEQLEFGLVREALRERELSLTTLAPHLVKPLKFLFPITHRVWERPYMA
AGIFLYDRMGGAKSVPAQKHLTRAGALRMAPGLKRNSLTGGIQYYDTVVDDARHTMTVAR
TAAHYGAVVRTSTQVVGFLREADRVSGVRVRDCEDGRTADVKAHVVINATGVWTDEIQAL
SRQRGRFRVRASKGVHIVVPRDRIVSDAAIILRTEKSVLFVIPWGSHWIIGTTDTDWNLD
LAHPAATKADIDYILGHVNKVLVTSLTHDDIDGVYAGLRPLLAGESDETSKLSREHAVAR
VAPGLVAIAGGKYTTYRVMAEDAVDLAADDIPARMAPSITEKVPLVGADGYFALVNQTVH
LGQMYGLHPYRVKHLLDRYGSLIDEVLDQASGKPELLQPITDAPAYLQVEVVYAAAAEGA
LHLDDILARRTRIAIEYSHRGVNCAEQVAQLVAPVLGWDADAVDREVKTYQARVEAEVQS
QAQPDDLSADALRAAAPESRVELLEPPVSVSEIP
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttcctcggtccccggcagcgtgatgccgcatgggacaagctgcagaccgaacag
ttcgacgtcgtcgtgatcggcgggggtgtcgtcggagccggtgcggcactcgacgcggcc
acccgcgggctgaaggtggcgttggtcgaggcacgcgattacgcgtccgggacgtcgagt
cgctcgtcgaagatgttccacggcggtctgcgctatctcgagcagctcgagttcggactg
gtccgggaggcgctccgggagcgtgagctgtcgctgaccaccctcgccccgcacctggtg
aagccgctcaagttcctgttcccgatcacccaccgcgtgtgggagcgcccctatatggcg
gcggggatcttcctctacgaccggatgggcggcgccaaatcggttccggcccaaaaacat
ctgacgcgagcgggtgcgctgcggatggcaccggggctcaagcgcaactcgctgaccggc
ggcatccagtactacgacaccgtcgtcgacgacgcccgtcacaccatgaccgtcgcccgc
accgccgctcactacggggcggtcgtgcgcacgtccacgcaggtggtcggattcctccgg
gaggcggaccgggtctccggagtgcgcgtccgggactgcgaggacggccgcaccgcggac
gtgaaggcgcacgtcgtcatcaacgccacgggggtgtggaccgacgagatccaggcgctg
tcgcggcaacgcggccggttccgcgtccgcgcgtccaagggcgtccacatcgtggtgccg
cgggatcggatcgtgagcgacgccgcgatcatcctccgcaccgagaagtcggtgctgttc
gtgatcccgtggggcagccactggatcatcgggaccaccgacacggattggaatctcgac
ctcgcgcacccggcggccaccaaggccgacatcgattacatcctcggtcatgtcaacaag
gtgctggtgacgtcgctgacccacgacgacatcgacggcgtctacgcgggcctgcgcccg
ctgctcgcgggggagagcgacgagacgtcgaaactgtcgcgggaacacgccgtcgcgcgt
gtcgcaccgggtctcgtcgccatcgccggcggcaagtacaccacctaccgggtgatggcc
gaggacgccgtggatctcgccgccgacgacattcccgcgcgaatggcgccgtccatcacg
gagaaggtaccgctcgtcggcgcggacggctatttcgcgctggtcaatcagaccgttcac
ctcggccagatgtacggacttcacccgtaccgcgtgaagcatctgctggaccggtacggt
tcgctgatcgacgaggtgctcgaccaggcgagcgggaaaccggagcttctccagcccatc
acggacgcaccggcctacctgcaggtcgaggtcgtgtatgcggcggcggccgagggtgcc
ctgcatctcgacgacatcctcgcccggcgcacgcgcatcgccatcgagtactcgcatcgg
ggtgtgaactgcgccgagcaggtggcgcaactggtggcccccgtcctcggctgggacgcc
gacgccgtcgaccgtgaggtgaagacgtatcaggcgcgggtggaggcggaggtgcagtcg
caggcccagccggacgacctgtcggccgacgcgttgcgggcggcggcgcccgagtcgcgg
gtcgaactgctcgaaccaccggtcagtgtgtcagaaataccttga

DBGET integrated database retrieval system