KEGG   Raoultella ornithinolytica B6: RORB6_01050Help
Entry
RORB6_01050       CDS       T02625                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ror  Raoultella ornithinolytica B6
Brite
Enzymes [BR:ror01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     RORB6_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AGJ84908
LinkDB All DBs
Position
complement(231971..232600)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGQKIILFLEEAQLAYRLIRVDINKGEQFRPQFLALSPNNKIPAIVDHLP
VDGGAPLGLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVSGLGPMLGQNHHFNH
SAPQAVPYAIERYQVETQRLYNVLNRRLEVSPWLGGEHYSIADIACWPWIRAHPRQRIDL
AHFPAIHNWFERIRQRPATGQALIKIQHQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctttactacgcacccacccctaacggccagaaaatcattctctttctcgaa
gaggcgcagctggcctatcgcctgattcgggtcgatatcaataaaggggaacagtttcgc
ccgcagtttctcgctctctcgccgaataataaaattcccgctatcgtcgaccacctcccc
gtcgacggcggagcgccgctcggcctgtttgagtcaggtgaaatcctgctctatctggcg
gaaaaatcaggaaaactgcttagcggtgagctgcgcgagcgccataccacgctacagtgg
ctgttctggcaggtcagcggattaggccctatgctggggcagaatcaccatttcaatcac
agcgcgccgcaggcggtgccctatgccatcgagcgttatcaggtcgagacccagcggttg
tacaacgtactgaaccgtcgtctggaggtcagcccatggctcggcggcgaacattacagt
attgccgatattgcctgctggccgtggattcgcgcccaccctcgccagcgtattgatctc
gcgcattttccggcgattcataactggtttgaacgcattcgtcagcgtccggctaccggg
caggcgctgataaaaatacaacaccaataa

DBGET integrated database retrieval system