KEGG   Rhodopseudomonas palustris HaA2: RPB_2266Help
Entry
RPB_2266          CDS       T00321                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
rpb  Rhodopseudomonas palustris HaA2
Brite
Translation factors [BR:rpb03012]
 Eukaryotic Type
  Elongation factors
   RPB_2266
 Prokaryotic Type
   RPB_2266
Mitochondrial biogenesis [BR:rpb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RPB_2266
Exosome [BR:rpb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RPB_2266
  Exosomal proteins of breast cancer cells
   RPB_2266
  Exosomal proteins of colorectal cancer cells
   RPB_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2614825..2616015
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIIKGSALAALE
NSDQKLGHDAILELMKAVDAYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNIGCLLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaaattcgaacgtaccaagccgcattgcaatatcgggacgatcggtcac
gtcgaccatggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagacgggc
ggcgcgacgttcacggcctacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatttcgacggctcacgtcgaatacgagacgacgaaccgccactacgcgcatgtc
gactgcccgggccacgccgactacgtgaagaacatgatcaccggtgcggcgcagatggac
ggcggcattctggtggtgtcggcggccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcgcgccaggtcggcgtgcccgctctcgtcgtgttcctgaacaagtgcgacatg
gtcgacgatccggaactgctcgaactggtcgagatggaagtgcgcgagcttctgtcgaag
tacgacttcccgggcgacgacattccgatcatcaagggctcggcgctggccgctctggag
aactcggatcagaagctcggccacgacgcgatcctggaactgatgaaggcggtcgacgcc
tacattccgcagccggagcgcccgatcgaccagccgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcacggtggtgaccggtcgcgtcgagcgcggcatcgtcaag
gtcggtgaggaaatcgagatcgtcggcatccgcgacacccagaagacgacctgcaccggc
gtcgaaatgttccgcaagctgctcgaccagggccaggccggcgacaacatcggctgcctg
ctgcgcggcaccaagcgcgaggacgtcgagcgcggccaggtgctgtgcaagccgggttcg
gtgaagccgcacaccaagttcaaggccgaggcctacattctgaccaaggaagagggcggc
cgtcacaccccgttcttcaccaactatcgtccgcagttctacttccgcaccaccgacgtc
accggcgtcgtgcatctgccggaaggcaccgaaatggtgatgccgggcgacaacatcgcc
atggaagtgcacctgatcgtgccgatcgcgatggaagaaaagctgcgcttcgccatccgc
gaaggcggccgcaccgtcggcgccggcgtggtggcctcgatcatcgagtaa

DBGET integrated database retrieval system