KEGG   Rhodopseudomonas palustris BisB5: RPD_1548Help
Entry
RPD_1548          CDS       T00345                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RPD_1548
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RPD_1548
Enzymes [BR:rpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RPD_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1726429..1726791)
Genome map
AA seq 120 aa AA seqDB search
MTTPIKDYQSRISDPNSRKLGTFSYLPPMDAEQLRKQINYIVNQGWTAAIEHTEPSHATG
YYWYMWKLPMFGETDVDRVLTEIEACRAANPNHHVRLIGYDNVVQTQGTSMLVYRAPIEV
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaccactccgataaaggactatcagtcccgtatctccgatccgaacagccgcaagctc
ggcaccttctcctatctgccgccgatggatgccgagcagctgcgcaagcagatcaactac
atcgtcaaccagggctggacggcggcgatcgagcacaccgagccgagccatgccaccggt
tactactggtacatgtggaagctgccgatgttcggtgagaccgacgtcgaccgtgtcctc
accgaaatcgaggcctgccgcgccgccaatccgaaccaccacgttcggctgatcggctac
gacaacgtcgtccagacccaaggcaccagcatgctggtgtatcgcgcaccgatcgaggtc
tga

DBGET integrated database retrieval system