KEGG   Ralstonia pickettii 12D: Rpic12D_2167Help
Entry
Rpic12D_2167      CDS       T00925                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpf  Ralstonia pickettii 12D
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic12D_2167
  Energy metabolism
   00680 Methane metabolism
    Rpic12D_2167
Enzymes [BR:rpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rpic12D_2167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:2306436..2309444
Genome map
AA seq 1002 aa AA seqDB search
MTQPAARRASSRATTARKASAAPAKTSKATKAIKAAKPAAKPVATANGADEANGASLGPT
SRRSSGSAAAKDQPLKEDIRFLGRLLGDVLREQEGGAAFETVETIRQTAVRFRRDGDRQA
EQELDRLLKALSREQTNSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPGSMMRA
LLSVADEGVSGETLRRFFDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDTPLTTR
ERERNTTLLRAHVTKLWQTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEEDVA
AVFPRRGARGEPTPLAPFFQMGSWIGGDRDGNPFVTAETLRYAARKQASVILAWYLEEIH
ALGAELSMSTSQVDVSAELLALAEQSPDRSEHRSDEPYRRALIGVYARLAATCRELTGED
AGRHAVGPAPAYSNAEELRADIQIVIDSLAAHHGEVLADARLASLARAIDVFGFHLSSID
LRQVSDVHEATVAELLKVAGVEGAYAALSEADKRTLLLRELQQPRVLTLPFHAYSEQTTS
EIDIFRAAREVRARYGNRIVRNYIISHTETLSDLLEVMLLQKEAGMFRTGANGSGSAALD
VMVIPLFETIEDLRNAPEIMGDLLDLPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSNW
ELYKAELALVELFQRKGVRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGE
IISSKFANPEIGRRNLETIVAATLEATLLPTRNRPKGLEEFEAAMQALSDNAFAAYRNLV
YETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKHRRIEDLRAIPWGFSWGQCRLLL
PGWFGFGSAVQRWLDDAGNAKARAARLTTLKRMHKQWPFFANLLSNMDMVLSKADLNVAS
RYAQLCDDRKLRNAVFSRISAEFTLTEQMLAAITGQSERLADNPLLARSIKNRFPYLDPL
NHLQVELLKRFRSGKAGSDDARVRRGIHLSINGIAAGLRNSG
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcccgccgcgcgccgcgcttcctcgcgcgcgacaaccgcccgcaaggcttcc
gccgctcccgccaagaccagcaaggccacgaaggccatcaaggctgccaagcccgccgcc
aaaccggtggccacggccaatggcgcggacgaagccaatggcgcatcactcggccccact
tcccggcgctcgtcgggcagcgccgcggccaaggatcagccgctgaaggaagacatccgc
ttcctcgggcgcctgctgggcgacgtgctgcgtgaacaggaaggtggcgccgccttcgaa
accgtcgagacgatccgccagaccgccgtgcgtttccgccgcgacggcgaccgccaggcc
gagcaggaactcgaccgcctgctgaaagccttgtcgcgtgagcaaaccaactccgtggtg
cgcgcgttcagctacttctctcacctggccaacattgccgaagaccagcaccacaaccgc
cgccgccgcgtgcatgcgctggcgggctcgccaccgcagccgggcagcatgatgcgcgcg
ctgctgtcggtggccgacgagggtgtctcgggtgagacgctgcgccgcttcttcgatgcc
gcgttgatcgtgcccgtgctcacggcccacccgaccgaggtgcagcgcaagagcattctc
gatgcacagcgtgaaatcgcccgcctgctggccgaacgcgacacgccgctgaccacccgc
gagcgtgaacgcaacacgacgctgctgcgcgcgcacgtgaccaaactgtggcagacacgc
atgctgcgcaccacgcgtctgatggtggccgacgagatcgaaaacgcgctgtcgtactac
cagacgacgttcctgcgcgagattcccgcgctgtaccgcgaactggaagaggacgtcgct
gccgtattcccgcgccgtggcgcacgtggcgaacccaccccgttggcgccgttcttccag
atgggctcgtggatcggcggcgaccgcgacggcaaccccttcgtcacggcagaaaccctg
cgctacgccgcccgcaagcaggccagcgtgatccttgcgtggtatctggaagagatccac
gcgctgggcgccgaactgtcgatgtcgacatcgcaggtggatgtgagtgctgaattgctg
gcgctggcggagcagtcgcccgatcgatcggagcatcgctcggatgagccataccgccgt
gcgctgatcggggtctatgcgcgactggccgccacctgccgtgagctgaccggtgaagac
gccggccgccacgccgtcgggcccgctccggcttacagcaacgcagaagaactgcgcgcc
gacatccagatcgtgatcgattcattggcggcgcaccacggcgaagtgctggccgatgcg
cgactggcatcgctggcgcgcgcgatcgatgtgttcggcttccacctgtcgtcgatcgac
ctgcggcaagtgtcggacgtgcacgaagcgaccgtcgccgagctgctgaaagtggccggt
gtggaaggcgcctatgctgcgctgtccgaggccgacaagcgcacgctgctgttgcgcgag
ctgcaacagccgcgcgtgctgacgctgccgttccatgcctacagcgagcagaccacgtcg
gagatcgacatcttccgcgctgcccgtgaggtgcgcgcccgctacggcaatcgcatcgtg
cgcaactacatcatttcgcacaccgagacgctgtccgacttgctcgaagtgatgttgctg
cagaaggaagccggcatgttccgcacgggcgccaatggcagcggcagtgccgcgctggac
gtcatggtgatcccactgttcgaaaccatcgaagacttgcgcaacgccccggaaatcatg
ggcgacctgctcgatctgcccggcttcgatgccgtactggccgcgcaaggcaacgagcag
gaagtcatgctcggctattcggattccaacaaggacggcggcttcctcacttctaactgg
gagctctacaaggccgaactggcgctggtggagctgttccagcgcaagggcgtgcgtctg
cgcctgttccacggccgcggcggcactgtcgggcgtggcggcggtccgacctaccaggcc
atcctgtcgcagccgccgggcacggtgaacgggcagatccgcctgactgagcagggcgag
atcatctccagcaagttcgccaatccagagattggccggcgcaacctggagaccatcgtc
gcggccacgctggaagccacgctgctgccaacgcgcaaccgcccgaagggtcttgaagag
ttcgaagcagccatgcaggcgctgtcggacaacgcctttgccgcgtaccgcaacctcgtc
tacgagaccccgggcttcaaggactacttcttcgccaccacgccgatcaccgagattgcc
gacctgaacctgggttcgcgcccggcctcgcgcaagctgatggacaagaaacaccgccgc
atcgaagacctgcgtgccattccgtggggcttctcatggggccagtgccgtctgctgctg
ccgggctggttcggctttggcagcgcggtgcagcgctggctcgacgatgcgggcaacgcc
aaggcccgtgctgcgcgcctgaccacgctcaagcgcatgcacaagcagtggccgttcttt
gcgaacctgctgtcgaacatggacatggtgctgtccaaggccgacctgaacgtggcgtcg
cgctacgcccaattgtgcgacgaccgcaagctgcgcaacgcggtgttctcgcgcatctct
gcggagttcacgttgaccgagcagatgctggcagccatcacgggacagtcggagcgcctg
gccgacaacccgctgctggcgcgctccatcaagaaccgcttcccgtaccttgacccgctg
aatcacctgcaggtcgaactgctcaagcgcttccgctcgggcaaggccggcagcgacgat
gcacgcgtgcggcgcggcattcatctgtcgatcaacgggattgccgcgggccttcgcaac
agcggctga

DBGET integrated database retrieval system