KEGG   Rhizobium phaseoli: AMC79_CH01426Help
Entry
AMC79_CH01426     CDS       T04590                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase (Cu-Zn)
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rpha  Rhizobium phaseoli
Brite
Enzymes [BR:rpha01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AMC79_CH01426 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ANL97249
LinkDB All DBs
Position
1452655..1453170
Genome map
AA seq 171 aa AA seqDB search
MKAMRIIAALSLLAIALPASAQDKQTAVANFVGKDGKESGRAQLTAAANGGVLIEVEISG
LPANKWVAFHVHETGRCDAATHHESAGGHFNPDSAEHGILAAKGPHAGDMPNQYVGQDGM
LRAQIFDGMVTLDGKKDGIRGRALMVHANSDDYRSQPSGDAGERLACGVIQ
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgcgaatcatcgctgccctgagcctgcttgcaattgccttgccggcgagt
gcccaggacaagcaaacggcggtcgccaatttcgtcggcaaggacggcaaggaaagcggc
cgcgcccagctaacggctgccgccaatggcggcgtcctgatcgaagtggagatatcggga
ctgccggcgaataaatgggtggcctttcatgttcacgagaccggccgctgcgatgcggca
acccatcacgaatcggcaggcggccatttcaacccggactcggccgagcacgggattctt
gcggccaaaggaccccatgccggcgatatgcccaatcaatatgtcggacaggacggcatg
ttgagagcccagatattcgacggcatggtcacgcttgacggcaagaaggacggcatccgc
ggccgcgctttgatggtgcacgccaattccgacgattatcgcagccagccttccggtgac
gccggggagaggcttgcctgcggcgtcattcaatag

DBGET integrated database retrieval system