KEGG   Rhizobium phaseoli: AMC79_CH02446Help
Entry
AMC79_CH02446     CDS       T04590                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rpha  Rhizobium phaseoli
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpha00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AMC79_CH02446
Enzymes [BR:rpha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AMC79_CH02446
Transporters [BR:rpha02000]
 Other Transporters
  Pores ion channels [TC:1]
   AMC79_CH02446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2468193..2468819
Genome map
AA seq 208 aa AA seqDB search
MTEELVFYTNPMSRGRIARWMLEEIGQPYRTELMTFGETMKAPEYLSVNPMGKVPAIRHG
TTVVTECAAICAYLAETFPEKGLAPEPEERAAYYRWMFFAAGPLESAVTMKALGFEIPAE
RLRMAGCGSFGDVMNTLEKAVSGSTYLAGERFTAADVYVGSHIGWGLAFGSIEKRQAFVD
YFGRISERPAGKRAKALDDEAGERMQAA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaagaattggtattctacacaaaccccatgtcacgcggccgcattgcgcgctgg
atgctggaggaaatcggtcaaccctatcgcaccgaactcatgaccttcggcgaaaccatg
aaggcgcccgaatatctctcggtcaatccgatgggcaaggtgccggcgatccgccacggc
accaccgtggtcaccgaatgtgcggcaatctgcgcctacctcgccgagaccttcccggaa
aaggggctggcccccgaaccggaagagcgcgccgcctattaccgctggatgttctttgcc
gccggcccgttggaatcggcggtgacgatgaaggcactcggcttcgaaattcccgcggag
cgcctgcgcatggccggctgcggcagtttcggcgacgtcatgaacacgcttgaaaaggct
gtgtccggctcgacctacctcgccggcgaacgcttcactgccgccgacgtctatgtcggt
tcccatatcggctgggggctcgcgttcggcagcatcgagaaacgccaggccttcgtcgat
tatttcggccgcatcagcgagcgtccggccggcaagcgcgccaaagccctggacgacgag
gccggcgagaggatgcaggccgcctga

DBGET integrated database retrieval system