Ralstonia pickettii 12J: Rpic_1183 Help Entry Rpic_1183         CDS       T00762                                  Name (GenBank) conserved hypothetical protein   KO K02686   primosomal replication protein N Organism rpi  Ralstonia pickettii 12J Pathway rpi03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rpi00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     Rpic_1183  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rpi03400]     Rpic_1183 DNA repair and recombination proteins [BR:rpi03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      Rpic_1183 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB Peptidase_A8 FAD_binding_6 Motif Other DBs NCBI-ProteinID:  ACD26327 UniProt:  B2UAG5 LinkDB All DBs Position 1:1271378..1271704 Genome browser AA seq 108 aa AA seqDB search MNETLGDNAINRLQLVATLVEREVMRYTPAGVPIVNCLLAYSGQAVEAQTVRQIEFSMEA LAAGKMASVLDRIAPGTVLDCVGFLARKHRSSKALVFHISGCNVFVKD NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgaacgaaaccctcggggacaacgccatcaaccgcctgcagctcgtggccactctggtc gagcgcgaggtgatgcgatacaccccagccggcgtgccgatcgtcaattgtctgctggca tacagcgggcaggcggtcgaagcgcagacagtgcggcagatcgagttttcgatggaggca ctggcagccggcaagatggcttccgttctggatcgcatcgctccgggcaccgtcctggat tgcgtgggattcctggctcgcaagcaccgcagcagtaaggcactggtctttcacatctcc ggatgtaacgtattcgtaaaggattga

DBGET integrated database retrieval system