KEGG   Ralstonia pickettii DTP0602: N234_26615Help
Entry
N234_26615        CDS       T03172                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rpj  Ralstonia pickettii DTP0602
Brite
Enzymes [BR:rpj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N234_26615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 17105225
NCBI-ProteinID: AGW93612
UniProt: U3QZS1
LinkDB All DBs
Position
2:complement(1217857..1218453)
Genome map
AA seq 198 aa AA seqDB search
MKQLLTPLAACIAATVALAGCAGSGKSSSASSGAAAAAPAAASASTTTGPSRASATLQPK
SGSNTAGTVSFQQQPGGVLMTAAITGLPPNTVHGFHVHEKGDCSAPDAMSAGGHFNPTGK
QHGQMTMPDHHAGDMNNVTADASGNVRVSMLLPSLTVGTGANSVIGRAVVVHKDPDDYKT
QPTGNAGGRIACGVVAAS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattgcttacccccctggctgcctgcatcgccgcgaccgtggcactggccggc
tgcgccggttccggcaagagctcctcggcctcatccggcgcggctgccgcagccccggcg
gcagccagtgcgtccacgacaaccggtccgagccgggcgagtgcgacgctgcagcccaag
agcggcagcaataccgccggcaccgtgtccttccagcagcagcccggcggcgtactgatg
accgccgcgatcacgggcctgccgcccaacacggtccatggctttcacgtccatgaaaaa
ggcgactgctccgcgcctgacgcgatgagcgcaggcgggcatttcaacccgaccggcaag
cagcatggccagatgaccatgcccgaccatcacgccggcgacatgaacaacgtgaccgcc
gacgccagtggcaacgtgcgcgtcagcatgctgctgccgtcgctgacggtgggcaccggc
gccaacagcgtgatcggccgcgcggtggtggtgcacaaggatccggacgattacaagacg
caaccgacgggtaatgctggcgggcgcattgcttgtggggtggtggcggcttcctga

DBGET integrated database retrieval system