KEGG   Ralstonia pickettii DTP0602: N234_28330Help
Entry
N234_28330        CDS       T03172                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rpj00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    N234_28330
Enzymes [BR:rpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     N234_28330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(1578923..1579354)
Genome map
AA seq 143 aa AA seqDB search
MRITQGTFSFLPDLTDAQITSQLEYCLGKGWAVGIEYTDDPHPRNTYWEMFGLPMFDLRD
AAGILLEINNARSTFPNHYIRVTAFDSTHTVESVVMSFIVNRPADEPGFRLVRQEEPGRT
MRYSIESYAVQARPEGSRYRGID
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattactcaaggcactttctccttcctgcccgacctcaccgacgcgcagatcacc
agccagctcgaatactgcctgggcaagggctgggcggtcggcatcgaatacaccgacgac
ccgcatccgcgcaatacctactgggagatgttcggcctgccgatgttcgacctgcgcgat
gccgccggcatcctgctggagatcaacaacgcccgcagcacctttcccaaccactacatc
cgcgtcacggccttcgattcgacccatacggtggagtcggtggtgatgtccttcatcgtc
aatcgtcccgccgacgaacccggcttccgcctggtgcggcaggaggagcccggccgcacg
atgcgctactcgatcgagagctacgccgtgcaggcgaggccggaaggtagtcgctaccgc
ggcatcgactga

DBGET integrated database retrieval system