KEGG   Ralstonia pickettii DTP0602: N234_31410Help
Entry
N234_31410        CDS       T03172                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00010  Glycolysis / Gluconeogenesis
rpj00620  Pyruvate metabolism
rpj01100  Metabolic pathways
rpj01110  Biosynthesis of secondary metabolites
rpj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N234_31410
   00620 Pyruvate metabolism
    N234_31410
Enzymes [BR:rpj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     N234_31410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 17106181
NCBI-ProteinID: AGW94556
UniProt: U3QZ63
LinkDB All DBs
Position
2:2264761..2266281
Genome map
AA seq 506 aa AA seqDB search
MNMAEIAQLGVSNPYKQQYENFIGGAWVPPAGGEYFESITPITGKPFTRVPRSNQQDVDA
ALDAAHAAKAAWARTSTTERANILNRIADRIEANLTLLAVAETIDNGKPVRETCAADLPL
AVDHFRYFASCIRSQEGGISEIDADTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMELIGDLLPPGVVNVINGFGLEAGKPLASSPRISKVAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESIYDRFMERALKRVAAIRQGHPLDKGTMIGAQASAEQLEKILSYIDLGR
KEGAQCLTGGERNALDGDLAGGYYVKPTVFAGHNKMRIFQEEIFGPVVSVTTFKDEEEAL
AIANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcggaaatcgcccagctgggcgtcagcaacccctacaagcaacagtacgag
aacttcatcggcggcgcctgggtgccgcccgccggtggcgagtactttgagtcgatcacg
ccgatcacaggcaagccgttcacgcgcgtgccgcgctccaaccagcaggatgtcgatgcc
gcgctggacgccgcgcacgccgccaaggccgcctgggcgcgcacctccaccaccgagcgc
gccaatatcctgaaccgcatcgccgaccgcatcgaggccaacctgacgctgctggccgtg
gccgagaccatcgacaacggcaagccggtgcgcgagacctgcgccgccgacctgccgctg
gcggtcgaccacttccgctactttgccagctgcatccgctcgcaggaaggcggcatctcc
gagatcgatgccgacaccgtggcctaccacttccatgagccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccacgtggaagctggccccggcgctggcg
gccggcaactgcgtggtgctcaagcccgccgagcagacccccgcctcgatcctggtgctg
atggaactgatcggcgacctgctgccgccgggcgtggtcaacgtgatcaacggcttcggg
ctggaagccggcaagccgctggcatcgagcccgcgcatcagcaaggtggccttcaccggc
gagaccaccaccgggcgcctgatcatgcaatacgcctcgcagaacctgatcccggtgacg
ctggaactgggcggcaagtcgccgaacatcttcttcgaggacgtgctggccgccgacgac
gccttcttcgacaaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgcgctgatccaggaatcgatctacgaccgcttcatggagcgc
gcgctcaagcgcgtggcggcgatccgccaggggcatccgctcgacaagggcaccatgatc
ggcgcgcaggcatcggccgaacaactcgagaagatcctgtcgtacatcgacctgggacgc
aaggaaggcgcgcagtgcctgacaggcggcgagcgcaatgcgctggacggcgacctcgcc
ggcggctactacgtgaagccgacggtattcgccggccacaacaagatgcgcatcttccag
gaagagatcttcgggccggtggtctcggtgacgaccttcaaggacgaggaagaagccctg
gcgatcgccaacgacacgctctacggcctgggcgcaggcgtgtggacgcgtgacggcgcg
cgcgcattccgcatggggcgcggcatccaggctggccgcgtgtggaccaactgctaccat
gcctatccggcgcatgcggcgttcgggggatacaagcagtccggcatcggccgtgagaac
catcgcatgatgctcgatcactaccagcaaaccaagaacctgctggtgagctacagcccc
aacgctctcggatttttctga

DBGET integrated database retrieval system