KEGG   Raoultella planticola: B1209_07195Help
Entry
B1209_07195       CDS       T05298                                 

Definition
(GenBank) thiol:disulfide oxidoreductase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
rpln  Raoultella planticola
Brite
Enzymes [BR:rpln01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     B1209_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C GST_N GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AUV52639
LinkDB All DBs
Position
complement(1472578..1473207)
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGQKIILFLEEAQLAYRLIRVDINKGEQFRPQFLALSPNNKIPAIVDHLP
VDGGAPLGLFESGEILLYLAEKSGKLLSGELRERHTTLQWLFWQVSGLGPMLGQNHHFNH
SAPQAVPYAIERYQVETQRLYNVLNRRLEVSPWLGGEHYSIADIACWPWIRAHPRQRIDL
AHFPAIHNWFERIRQRPATGQALIKIQHQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctttactacgcacccacccctaacggccagaaaattattctctttctcgaa
gaggcgcagctggcctaccgcctgattcgggtcgatatcaataaaggggaacagtttcgc
ccgcagtttctcgctctctcgccgaataataaaattcccgccatcgtcgaccacctcccc
gttgacggtggagcgccgctcggcctgtttgagtccggggaaatcctgctctatctggca
gaaaaatcaggaaaactgctcagcggcgagctgcgtgagcgccataccacgctccagtgg
ctgttctggcaggttagcggattaggccctatgctggggcagaaccaccatttcaaccac
agcgcgccgcaggcggtgccctatgccatagagcgttatcaggtcgagacccagcggttg
tacaacgtactgaaccgtcgtctggaggtcagcccatggctcggcggcgaacattacagt
attgccgatattgcctgctggccgtggattcgcgcccaccctcgccagcgtattgatctc
gcgcattttccggcgattcataactggtttgaacgcattcgtcagcgtccggccaccggg
caggcgctgataaaaatacaacaccaataa

DBGET integrated database retrieval system