KEGG   Pararhodospirillum photometricum: RSPPHO_02356Help
Entry
RSPPHO_02356      CDS       T01851                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rpm  Pararhodospirillum photometricum
Brite
Enzymes [BR:rpm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RSPPHO_02356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2813781..2814488
Genome map
AA seq 235 aa AA seqDB search
MVAYPSQREVPAINLEHPGAPQKAARPFFRWRVSAMAFVLPPLPFAQDALEPHMSAQTLS
FHHGKHHNAYVTNLNALIADTPLATQSLEEIIRETHGDPSRVGVFNNAAQVWNHTFFWSG
LKPGGGGTPSGALLDALTAAFGSFDAFKDQFKQTAVSQFGSGWAWLVLDKGTLRLTKTGN
ADVPLTSGQVPLLTCDVWEHAYYLDFQNRRPDFVQTFLDHLINWDFVASNFQAAQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttggtggcgtacccttcacaacgcgaagttccagccataaatctggagcacccgggcgcg
ccgcaaaaggctgcccgcccttttttccgatggagagtctccgcgatggcttttgttctc
ccgcccctccccttcgcccaggacgccctcgagccccatatgtcggcgcaaaccctgtcg
ttccaccatggcaagcatcataacgcctatgtcacgaacctgaacgccctgatcgccgac
accccgcttgcgacgcagtcgctggaggaaatcatccgcgaaacccacggcgatccgtcg
cgtgtcggggtgtttaataatgccgcccaggtgtggaatcacaccttcttctggagtggt
ttgaagcccggcggcggcgggaccccaagcggcgccctgctcgacgccctgacggccgcc
tttggctccttcgatgcctttaaggatcagttcaagcaaaccgctgtgagtcagttcggc
agcggctgggcgtggctggtcttggacaaggggactctgcgcctgaccaaaaccggcaac
gccgatgttcccctgaccagcggtcaagtgcccctgctcacctgcgacgtctgggagcat
gcctattatctcgatttccagaaccgccggcccgattttgtccaaaccttcctcgatcat
ctgataaactgggacttcgtcgcttccaatttccaggcggcgcagtaa

DBGET integrated database retrieval system