KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2154Help
Entry
Rpdx1_2154        CDS       T01381                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
rpx  Rhodopseudomonas palustris DX-1
Brite
Translation factors [BR:rpx03012]
 Eukaryotic Type
  Elongation factors
   Rpdx1_2154
 Prokaryotic Type
   Rpdx1_2154
Mitochondrial biogenesis [BR:rpx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rpdx1_2154
Exosome [BR:rpx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rpdx1_2154
  Exosomal proteins of breast cancer cells
   Rpdx1_2154
  Exosomal proteins of colorectal cancer cells
   Rpdx1_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2315465..2316655
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIVKGSALAALE
NSDQKLGHDAILELMRQVDAYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVAAIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtacgaagccgcattgcaacatcgggacgatcggtcac
gtcgaccatggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagacgggc
ggtgcgacgttcacggcctacgaccagatcgacaaggcgcctgaagagaaggcgcgcggc
atcacgatttcgaccgcgcatgtcgagtacgagacgcagaaccgtcactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgcgatcctggtggtgtcggcggccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcgcgtcaggtgggcgttccggcgctggtggtgttcctgaacaagtgcgacatg
gtcgacgatccggaactgctcgagctggtcgagatggaagtgcgcgagcttctgtcgaag
tacgactttccgggcgacgacattccgatcgtcaagggctcggcgctggcggcgctggag
aactccgaccagaagctcgggcacgacgcgatcctggagctgatgcgccaggtcgacgcc
tacatcccgcagccggagcgtccgatcgaccagccgttcctgatgccggtcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggtcgtgtcgagcgcggcgtgatcaag
gtcggcgaggaaatcgagatcgtcggcatccgcgacacgcagaagaccacctgcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggccggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgtgaggacgtcgagcgcggccaggtgctctgcaagccgggctcg
gtgaagccgcacaccaagttcaaggccgaagcctacatcctcaccaaggaagagggcggc
cgccacaccccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgtggtgcacctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagaaaagctgcgcttcgccatccgc
gaaggcggccgcacggttggagcaggagtggttgctgcgatcattgaatga

DBGET integrated database retrieval system