KEGG   Rhodospirillum rubrum F11: F11_00115Help
Entry
F11_00115         CDS       T02006                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    F11_00115
Enzymes [BR:rrf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     F11_00115
Transporters [BR:rrf02000]
 Other Transporters
  Pores ion channels [TC:1]
   F11_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
27098..27766
Genome map
AA seq 222 aa AA seqDB search
MRRLYHHGLSPAARKVRVALAEKRLDYEAVIEETWIRNESFLAMNPEGEVPVLVEADGLT
ITDGWAICEYLEEVYPEPSLLGGPAAMRAEVRRLVAWFDRKFNREVTEPLVREKLLKRVI
SGGAPDSRQIRAGRANVHTHLRYISWLIDRRRWLAGDMLTYADITAACHLSLIDYAGDVP
WEDHPQAKEWYALVKSRPSFRPLLTETISPIRPPRHYADLDF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagactttatcaccatgggctctccccggcggcccgtaaggtccgggtcgccctt
gccgaaaagcggctcgattacgaagccgtgatcgaagagacctggattcgcaacgaatcc
ttcctggcgatgaacccggaaggcgaggttccggtgctggtcgaggccgatggtttgacc
atcaccgatggctgggcgatctgcgaatatctggaagaggtctatcccgaaccgtcgttg
ctgggcggtcctgcggccatgcgcgccgaggtgcggcggctggtggcttggttcgaccgc
aagttcaaccgcgaggtgaccgagccgctggtgcgcgaaaagctgctcaagcgggtgatt
tccggcggcgcccccgacagccggcagatccgcgccgggcgggccaatgtccatacccac
ctgcgctatatctcctggctgatcgaccgccggcgctggctggcgggggatatgctgacc
tatgccgatatcacggcggcctgccatctgtcgctgatcgactatgcgggggatgtgccg
tgggaagaccatccccaggccaaggaatggtatgccctggtcaagtcgcgcccaagtttc
cggccgctgctgaccgagacgatttcgccaatccgccccccccgccattacgccgatctg
gatttctaa

DBGET integrated database retrieval system