KEGG   Rhodospirillum rubrum F11: F11_08280Help
Entry
F11_08280         CDS       T02006                                 

Definition
(GenBank) alpha amylase, catalytic region
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F11_08280
Enzymes [BR:rrf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     F11_08280
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     F11_08280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1893256..1896558
Genome map
AA seq 1100 aa AA seqDB search
MSDFLWYKDAIVYQLHVKAFFDSNGDGFGDFKGLTEKLDYLSDLGVTAVWILPFYPSPLR
DDGYDIADYKAIHRAYGTMGDFRRFVREAHERGLKVITELVINHTSDQHAWFQRAREAKP
GSKARDMYVWSDTDQRYLDTRIIFTDTETSNWAWDPLAKAYYWHRFFAHQPDLNWDNPRI
FEEITRVMKFWLDCGVDGMRLDAIPYLVERDGTNNENLPETHVVLKRLRAWLDAHYEDRM
FLAEANQWPEDVREYFGEAGDECHMAFHFPVMPRIYMAVAQEDRHPITDIMRQTPEIPAA
CQWAIFLRNHDELTLEMVTDRERDYMNTFYANDSRARINVGIRRRLAPLLDNDRRKIELL
NSLLMSMPGTPIIYYGDEIGMGDNIFLGDRDGVRTPMQWSPDRNGGFSRADPASLYLPTI
MDAVYGFFAVNVEAQSRSPSSLLNWMRRLIAVRKRHPSFGRGTLRFLYPGNRKILAYLRE
FEGEVILCVANLSRAPQPAELGLAEFSGRVPVEMLGNSVFPPIGELHYFITLPAYGFYWF
RLSKGEGPSWHEPPVEPLPDLSTLVLPRIWDSLGSDGPLRQIQGDILPAFLPKQRWFSGK
EHSLRGVEMTDHAVISAPGAASGWMLALWRADYKDGAPGQTFQLPLDIAWESREDDPLSR
LLPFTLARVRRVNRVGALYDAMAGPAFPLALVQAMAEGANVTTAKGGGLRFTRTQAFPAG
PLPGPEAVARLGREQSNTSIKLGEDMVLKLYRRVEAGIHPEIEIGRFLTDVAGFANAPPL
LGALEHIDAKGAISALAVLQGFVRNQGDGWDYMLAYLDRFLDDRAQAPAEVGEGGGPAGS
PHGIIHAQADILGQRVAELHHAFATPTEDPAFSAEAVGPEDLASWREQVRTQAAQARQAL
DTALPGLSAEVAGLVTRLLDCWERIDARVDAPISLAEGLVKTRIHGDLHLGQVVVVRDDF
HILDFEGEPVKGLSERRDKHCPLKDVAGMLRSFDYAAWSAALSFRQTHAEVRIDVLPALG
VWQEEIREAFLAGYDRAIAGCPSVPALEEGRRDLLSLFMLEKALYEVSYEAANRPDWLRI
PIGGVLRLLGEGPSDEIKPR
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttcctatggtacaaggacgccatcgtctatcagcttcatgtaaaagccttt
tttgattcgaacggtgacgggttcggcgatttcaaggggctgaccgaaaagctggattac
ctctccgatcttggggtgacggcggtgtggatcttgccgttctatccctcgccgctgcgc
gatgacggctatgacatcgccgattacaaggccatccaccgcgcctatggcaccatgggc
gatttccgccgcttcgtgcgcgaggcccatgagcgcgggttgaaggtcatcaccgaactg
gtgatcaatcacaccagcgatcagcacgcctggttccagcgcgcccgcgaagccaagccc
ggcagcaaggcccgcgacatgtacgtgtggtccgacaccgaccagcgctatttggatacg
cgcatcattttcaccgataccgaaacctcgaactgggcctgggatccgctggccaaggcc
tattactggcaccgcttcttcgcccatcagcccgatctcaactgggacaatccgcgaatt
ttcgaggagatcacccgggtgatgaagttctggcttgattgcggcgtcgatggcatgcgc
ctggacgccattccttatttggtcgaacgcgacggcacgaataacgaaaacctgcccgaa
acccatgtcgtcctcaagcggctgcgcgcttggcttgatgcccattatgaagaccggatg
ttcctggccgaggccaatcaatggcccgaggacgtgcgcgagtatttcggcgaagccggc
gacgaatgccacatggccttccactttccggtgatgccgcgcatctatatggccgtggcc
caggaagaccgccatccgatcaccgatatcatgcgccagaccccggagatcccagcggct
tgccaatgggcgatcttcctgcgcaatcacgatgaactgacgctcgaaatggtcaccgac
cgcgagcgcgactatatgaacaccttctatgccaatgattcgcgggcccgaatcaacgtc
ggcatccgtcggcgcctggcgcctttgcttgataacgatcgccgcaagatcgaattgctc
aacagccttttgatgtcgatgccgggtacgccgatcatctattacggcgacgagatcggc
atgggcgacaatattttcctgggcgatcgcgatggcgtgcgcacgcccatgcaatggtcg
cccgaccgcaacggcggcttttcgcgggccgatcccgcctcgctttatctgccgacgatc
atggatgcggtctatggcttcttcgccgtcaatgtcgaggcccagtcgcgctcgccatcc
tcgctgctcaactggatgcgccggctgatcgccgtgcgcaagcgccacccctccttcggg
cgcggcaccttgcgctttctctatcccggcaaccgcaagatcctggcttacttgcgggaa
ttcgagggcgaggtgatcttgtgcgtggccaatctgtcgcgtgccccgcagccggccgaa
ttggggctggccgagttttccgggcgggttccggtcgagatgctgggcaacagcgtcttt
ccgccgatcggcgagttgcactatttcatcaccctgccggcctatggcttctattggttc
cgcctgtcgaagggcgaggggccgagctggcatgaaccgccggtcgagcccttgcccgat
ctttcgaccctggttcttccccgtatctgggacagcctgggcagcgatgggcccttgcgc
cagatccagggggatatcctgccggccttcctgcccaagcaacgctggttctctggcaag
gagcattccctgcgcggcgtcgagatgaccgaccacgcggtgatttcggcccccggcgcc
gcttcgggctggatgctcgccctgtggcgcgccgattacaaggatggcgccccggggcaa
accttccaattgccccttgatatcgcctgggaaagtcgcgaggacgatcccttgtcccgg
ctgctgccctttaccttggcccgggtgcggcgggtcaaccgcgttggcgccctctatgac
gccatggccggcccggctttcccgctcgccttggtgcaggcgatggccgaaggcgcgaac
gtgacgacggccaagggcggcggtttgcgcttcacccggacccaggccttccccgccggc
ccgcttcccggccccgaagcggtggcccgcctggggcgtgagcaatccaacacctcgatc
aaacttggcgaggatatggttctcaagctctatcgccgggtcgaggccgggattcatcca
gaaatcgaaatcggccgcttcctgaccgatgtcgccggcttcgccaacgccccgccgctg
cttggcgcgctcgagcatatcgatgctaagggcgccatctcggccctggcggtgctgcag
ggcttcgtgcgcaatcagggcgatggctgggactacatgctggcctatctcgaccgcttc
ctcgacgacagggcccaggcgccggccgaggtcggcgagggcggcgggccggccggctcg
ccccatggcatcatccacgcccaggccgatatccttggccagcgcgtcgccgagcttcac
cacgccttcgccaccccgaccgaggacccggccttttccgccgaagccgtcgggccggag
gatctggcgagctggcgcgagcaagtgcgcacccaggcggcccaggcccgtcaggccctt
gacaccgccttgcccgggctgtccgcagaggtggcggggctggtcacccgactgctggac
tgctgggagcggatcgacgcccgcgtcgacgcgccgatttctttggccgaggggctggtc
aaaacccgcatccatggcgaccttcatctggggcaggtggtggtggtgcgcgatgacttc
catattctcgatttcgagggcgagccggtgaagggactgagtgagcggcgcgacaaacac
tgcccgttgaaagacgtggccggcatgcttcgctcgttcgattacgcggcgtggtcggcg
gcgctgagcttccgccaaacccatgccgaggtgcggatcgacgtactgcccgcgcttggc
gtttggcaggaggaaatccgcgaggctttcctcgccggctatgaccgggccatcgccgga
tgtccctcggttccggcccttgaggaggggcgaagggacctcctttcactattcatgctg
gaaaaagccctctatgaggtatcttacgaagccgccaatcgtccggactggttacgaatt
cccatcggcggcgttttgcgcctgcttggagaggggccatcggacgagatcaaaccgcgt
tga

DBGET integrated database retrieval system