KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104655861Help
Entry
104655861         CDS       T03989                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:rro00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    104655861 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    104655861 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    104655861 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    104655861 (PTGS1)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104655861 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 599 aa AA seqDB search
MSRSLLLRFLLLLLLLLQLPVLLADPAAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIRIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVRSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQSAGRIGGGRNMDRHVLHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEMGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctccggttcttgctgctcctgctcctgctgctgcagctcccg
gtcctgctcgcggacccggcggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgc
acgggctattccggccccaactgcaccatccctggcctgtggacctggctccggaattca
ttgcggcccagcccctctttcacccactttctgctcacacacgggcgctggttctgggag
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagactgccccacg
cccatgggaaccaaagggaagaagcagttgccagatgcccagctcctggcccgccgcttc
ctgctcaggaggaagttcatacctgacccccaaggcacgaacctcatgtttgccttcttt
gcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcctggcttcacc
aaggccttgggccatggggtagacctcggtcacatttatggagacaatctggagcgtcag
tatcaactgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagaaatg
tacccgccctcggtagaagaggcgcctgtgttgatgcactatccccgaggcatcccgccc
cagagccagatggcggtgggccaggaggtgtttgggctgcttcccgggctcatgctgtat
gccacgctctggctacgcgagcacaatcgtgtgtgtgacctgctgaaggctgagcacccc
acctggggtgatgagcagcttttccagacgacccgcctcatcctcataggggagaccatc
aggattgtcatcgaggagtatgtgcagcagctgagtggctacttcctgcagctaaagttt
gacccagagttgctgtttggtgtccagttccagtaccgcaatcgcattgccatggagttc
aaccatctctaccactggcaccccctcatgcctgactccttcaaggtgcgctcccaggag
tacagctacgagcagttcttgttcaacacctccatgttggtggactatggggtcgaggcc
ctggtggatgccttctctcgccagagcgctggccggatcggtgggggcaggaacatggac
cgccacgtcctgcacgtggctgtggatgtcatcagggagtctcgggagatgcggctgcaa
cccttcaatgagtaccgcaagaggtttggcatgaagccctacacctccttccaggagctc
gtaggagagaaggagatggcagcggagttggaggagctgtatggagacattgatgcgttg
gagttctaccctgggctgcttcttgaaaagtgccatccaaactctatatttggggagagt
atgatagagattggggctcccttttccctcaagggtctcctagggaatcccatctgttct
ccggagtactggaagccgagcacatttggcggcgagatgggctttaacatcgtcaagacg
gccacactgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgt
gtgccggatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system