KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675473Help
Entry
104675473         CDS       T03989                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:rro00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    104675473
   04614 Renin-angiotensin system
    104675473
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    104675473
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    104675473
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     104675473
Peptidases [BR:rro01002]
 Metallo Peptidases
  Family M2
   104675473
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104675473
CD molecules [BR:rro04090]
 Proteins
  104675473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1307 aa AA seqDB search
MGAASGRRGPGPLLLLLLLLLPPPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQ
VLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPILQNFTDPELRK
IIGAVGTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASS
RSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFSDTGAYWRSWYNSPTFEDD
LEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVP
FPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVC
HASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEA
IGDVLALSVSTPAHLHKIGLLDRVTNDTEGDINYLLKMALEKIAFLPFGYLVDQWRWGVF
NGRTPPSHYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQ
FHEALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGSDALDAQPL
LNYFQPVTQWLQEQNRQNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEASKFVEEYDRT
SQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARRFDVNHFQNTTIKR
IIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCRTNGSCLQLEPDLTNVMATSRK
YEELLWAWEGWRDKAGRAIVQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLE
RLFQELQPLYLNLHAYVRRALHRHYGAQHVNLEGPIPAHLLGNMWAQTWSNIYDLVVPFP
SAPSMDPTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPADGREVVCHA
SAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIG
DVLALSVSTPKHLHSLNLLSSEGGSHEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDG
SITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFISFIIQFQFH
EALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAILS
YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQ
WLLLFLGIALLVATLGLSQRLFSIRHQSLRQHPQGPQFGSEVELRHS
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccgggggccggggccgctgctgctactgttgctgctgctg
ctgccgccgccgccgcagcccgccctggcgctggaccccgggctgcagcccggcaacttt
tccgccgacgaggccggggcgcagctcttcgcgcagagctacaactcgagcgccgaacag
gtgctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgccgagaac
gcaaggcgccaggaggaagcagcgctgctcagccaggagtttgccgaggcctggggccag
aaggcgaaggagctgtatgaaccgatcttgcagaacttcaccgacccggagctgcgcaag
atcatcggagctgtgggcaccctgggctctgccaatctgcccctggctaagcggcagcag
tacaatgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctcccc
aacaagactgccacctgctggtccctggacccagacctcaccaacatcctggcttcctcg
cgaagctacgccatgctcctgtttgcctgggagggctggcacaacgccgcgggcatcccg
ctgaaaccgctgtacgaggacttcactgccctcagcaatgaagcctacaagcaggacggc
ttctcagacacgggggcctactggcgctcctggtacaactcccccacttttgaggacgat
ctggagcacctctatcaacagctagagcccctctacctgaacctccatgcctttgtccgc
cgtgcactgcatcgccgatatggggacagatacatcaacctcaggggacccatccctgct
catctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcct
ttcccagacaagcccaaccttgatgtcaccagtactatgctgcagcagggctggaatgcc
acgcacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcct
cccgagttctgggaagggtcgatgctggagaagccggccgacgggcgggaggtggtgtgc
cacgcctcggcttgggacttctacaacaggaaagacttcaggatcaagcaatgcacacgg
gtcacgatggaccagctctctacagtgcaccacgagatgggccatatacagtactacctg
caatacaaggacctgcccgtctccctgcgcgggggggccaaccccggcttccatgaggcc
attggggacgtgctggcactctcggtctccactcctgcacatctgcacaaaatcggcctg
ctggaccgtgtcaccaatgacacggaaggtgacatcaattacttgctaaagatggcactg
gaaaaaattgccttcctgccctttggctacctggtggaccagtggcgctggggggtcttt
aatgggcgtactcccccttcccactacaacttcgactggtggtatcttcgaaccaagtat
caggggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagttt
catgttccaaatgtgacaccatacatcaggtactttgtgagttttgtcctgcagttccag
ttccatgaagccctgtgcaaggaggcaggctatgagggcccactgcaccaatgtgacatc
taccagtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccagg
ccctggcaggaggtgctgaaggacatggtcggctcagatgccctggacgcccagccactg
ctcaactacttccagccggtcacccagtggctgcaggagcagaaccggcagaacggcgag
gtcctgggctggcctgagtaccagtggcgcccaccgttgcctgacaactacccggagggc
atcgacctggtgaccgatgaggctgaggccagcaagttcgtggaggaatatgaccggaca
tcccaggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacattacc
acagagaccagcaagattctgctgcagaagaacatgcaaatagccaaccatactctgaag
tacggcacccaggccaggaggtttgatgtgaaccacttccagaacaccactatcaagcgg
atcataaagaaggttcaggacctagaacgggcagcgctgcctgcccaggagctggaggag
tataacaagatcctgttggacatggaaaccacctacagcgtggccactgtatgccgcacg
aatggcagctgcctgcagctggagccagatctgacgaatgtgatggccacgtcccggaaa
tatgaagaactgttgtgggcgtgggagggctggcgagacaaggctgggagagccatcgtc
cagttttacccaaaatatgtggaactgatcaaccaggctgcccggctcaatggctatgta
gatgccggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggag
cggctcttccaggagctgcaaccgctgtacctgaacctgcatgcctacgtgcgccgggcc
ctgcaccgccactacggggcccagcacgtcaatctggaggggcccatccctgctcacctg
ctggggaacatgtgggcgcagacctggtccaacatctatgacttggtggtgcccttccct
tcagccccctcgatggaccccacggaggccatgctaaagcagggctggacgccccggagg
atgtttaaggaggctgatgatttcttcacctccctggggctgcttcccgtgcctcctgag
ttctggaacaagtcgatgctggagaagccagccgacgggcgagaggtggtctgccacgcc
tcggcctgggacttctacaacggcaaggacttccggatcaagcagtgcactaccgtgaac
ttggaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtac
aaagacttgcctgtggccttgagggagggtgccaaccccggcttccatgaggccattggg
gacgtgctagccctctcagtgtctacgcccaagcacctgcacagtctgaacctgctgagc
agtgagggtggcagccacgagcacgatatcaactttctgatgaagatggcgcttgacaag
atcgcctttatccccttcagctatcttgttgatcagtggcgctggagggtgtttgacgga
agcatcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggc
ctctgccccccggtgcccaggactcaaggtgactttgacccaggggccaagttccacatt
ccttctagcgtgccttacatcaggtacttcatcagcttcatcatccagttccagttccac
gaagcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccag
tccaaggaggcagggcagcgcctggcgacggccatgaagctgggcttcagtaggccgtgg
ccagaagccatgcagctgatcacgggccagcccaatatgagcgcctcggccatcctgagc
tacttcaagccgctgctggactggctccgcacagagaatgagctgcacggggagaagctg
ggctggccacagtacaactggacaccgaactccgctcgctcagaagggcccctcccagac
agcggccgcgtcagcttcctgggcctggacctggatgcacagcaggcccgcgtgggccag
tggctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcgg
ctcttcagcatccgccaccaaagcctccgccagcacccccaggggccccagttcggctcc
gaggtggagctgagacactcctga

DBGET integrated database retrieval system