KEGG   Rhodococcus ruber: CS378_02985Help
Entry
CS378_02985       CDS       T05142                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00620  Pyruvate metabolism
rrz00680  Methane metabolism
rrz01100  Metabolic pathways
rrz01120  Microbial metabolism in diverse environments
rrz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CS378_02985
  Energy metabolism
   00680 Methane metabolism
    CS378_02985
Enzymes [BR:rrz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CS378_02985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATQ27799
LinkDB All DBs
Position
640825..643596
Genome map
AA seq 923 aa AA seqDB search
MTDTARPADPSGSRSATEPLRQDIRLLGGMLGRIVREQAGEHLFALVERARVESFRVRRS
EIDRAELAAMFADVPTDDTLPVIRAFSHFALLANLAEDLHRERRRAVHVRAGEPAQDSSL
AATYRKLDAAELDPAEVAAALDGALVSPVITAHPTETRRRTVFDVQTRITDLMRRRERAE
PDERSDIDLHLWRQILTLWQTALIRLARLRIQDEIEVGLRYYDAALFRVVPALNAEVRRA
LRERWPGVPLLPDPLVRTGTWIGGDRDGNPNVTAEVVHRATDRAAATALGHHLAELERLE
QELSMSARLVRVTDDLARLADASGDAAPSRADEPYRRALRGIRGRLTATAARLLDDPPPH
AVPSRLTAYDTPAELLADLDILDAALRAGGSAVLADDRLAHVRGAVEAFGFHLASLDLRQ
NAEVHGRVIAELFSWAGVTDDYPALPEEEKVALLAAELRTRRPLSAPGARLGADTARELG
VLRAAADAVTRLGPDAVPHYIVSMCSSVSDLLEALVLLDEAGLVEHDIAGPRCPVAVIPL
FETIDDLRHGAEILTAALAVPEFRNLVDSAGGVQEVMLGYSDSNKDGGYLAANWALYRAE
LDLVEAARTAGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVAGSLRLTEQGEVIAAKY
AEPKLARRNLESLVAATLESTLLDVEGLGSDAGPAYAVLDELAELARAAYSDLVHETPGF
VEYFRTATPVAEIGALNIGSRPTSRKPTSSIADLRAIPWVLAWTQSRVMLPGWYGTGTAV
ETWIAGDEARLATLTGLYRRWPFFRTVLSNMAMVLAKSDLGLAARYAELVPDPDLRDRVF
DKITAEHERTVRVYLAITGHSELTADNPALARSVHNRFPYLEPLNHLQVELLRRFRAGED
TDRVRRGIQLTMNGLATALRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgacggataccgcccgcccggccgacccctccgggtcccgctccgccaccgaacctctg
cgccaggacatccggctgctcggcgggatgctgggccgcatcgtccgcgaacaggccggc
gagcacctcttcgccctcgtcgaacgcgcccgcgtcgagagcttccgcgtgcgccgctcc
gagatcgaccgcgccgaactcgcggcgatgttcgccgacgtccccaccgacgacaccctc
cccgtcatccgggccttcagccacttcgcgctgctggcgaacctcgccgaggacctgcac
cgggaacgccgccgcgccgtgcacgtgcgcgccggggagccggcacaggacagctccctg
gccgccacctaccgcaagctcgacgccgccgaactcgaccccgccgaggtcgccgccgcg
ctcgacggcgccctcgtctccccggtgatcaccgcccaccccaccgagacccgccgccgc
accgtcttcgacgtgcagacccgcatcaccgatctcatgcgccgccgcgaacgcgccgaa
cccgacgagcgatccgacatcgacctgcacctgtggcggcagatcctcaccctgtggcag
accgccctcatccggctcgcccgcctgcgcatccaggacgagatcgaagtgggcctgcgc
tactacgacgccgccctgttccgcgtcgtcccggccctcaacgccgaggtccggcgcgcc
ctgcgcgaacgctggcccggcgtcccgctgctgccggacccgttggtgcgcaccggaacc
tggatcggcggcgaccgcgacggcaaccccaacgtcaccgccgaggtcgtccaccgcgcc
accgaccgggccgccgcgaccgccctcggccatcacctcgccgagctcgaacggctcgag
caggagctgtcgatgtccgcacgtctggtccgcgtcaccgacgacctggcccgcctcgcc
gacgcctccggtgacgccgccccgtcgcgcgctgacgaaccgtaccgccgcgcgctgcgc
ggcatccggggccgcctgaccgccaccgcggcgcgactgctcgacgacccaccgccgcac
gcggtgccgagccggctgaccgcctacgacacgcccgccgaactgctcgccgacctcgac
atcctcgacgccgccctgcgcgccggcggcagcgcggtcctcgccgacgaccggctcgcg
cacgtgcgcggcgccgtcgaggctttcggcttccacctcgcctccctcgacctgcggcag
aacgcggaggtgcacggccgggtgatcgccgaactgttcagctgggccggtgtcaccgac
gactacccggcgctgcccgaggaggagaaggtcgcgctgctcgcggccgaactgcgcacc
cgccgtcccctcagcgcgcccggcgcgcggctcggcgccgacaccgcccgtgaactcggc
gtgctccgtgccgccgccgacgccgtgacccggttgggcccggatgccgtgccgcactac
atcgtcagcatgtgcagctcggtctcggatctgctcgaggcgctggttctgctcgacgag
gccggcctcgtcgagcacgacatcgccgggccgcgctgcccggtcgcggtgatcccgctg
ttcgagaccatcgacgatctgcggcacggcgccgagatcctcaccgccgccctcgccgtc
cccgagttccgcaacctcgtcgactccgccggcggggtccaggaggtcatgctgggctat
tcggactcgaacaaggacggcggctacctcgccgcgaactgggcgctgtaccgggccgaa
ctcgacctggtggaggccgcgcgcaccgccgggatccggctgcgcctgttccacggccgc
ggcggcaccgtcggtcgcggcggcggaccgagctacgacgcgatccttgcgcagccgccc
ggggccgtcgccggctcgctgcgcctgaccgagcagggtgaggtgatcgcggcgaagtac
gccgagccgaagctggcgcgccgcaatctcgagtccctcgtcgccgcgaccctcgagtcc
accctcctcgacgtcgagggactcggcagcgacgccggcccggcgtacgcggtgctcgac
gagctcgccgaacttgcccgcgccgcctacagcgatctcgtgcacgagaccccgggcttc
gtcgagtacttccggacggccacgccggtcgcggagatcggggccctgaacatcggcagc
cggcccacctcgcgcaagccgacgtcgtcgatcgccgacctgcgggcgatcccctgggtg
ctggcatggacccagtcccgtgtcatgctgcccggctggtacggcaccgggacggccgtc
gagacctggatcgcgggcgacgaggcgcgcctggccaccctcaccggcctgtatcggcgc
tggccgttcttccgcaccgtgctgtccaacatggcgatggtgctggccaagtccgacctc
ggtctcgcggcgcgctacgccgaactggtgccggacccggacctgcgggaccgggtgttc
gacaagatcaccgcggaacacgagcgcaccgtgcgcgtctacctggcgatcacggggcac
tccgagctcaccgcggacaacccggcgctcgcccggtcggtgcacaaccgcttcccgtac
ctcgagccgctgaaccacctgcaggtcgagttgctgcgccggttccgggcgggggaggac
accgaccgggtccgccgcggcatccagctgacgatgaacggcctcgcgaccgcgctgcgg
aacagcggctag

DBGET integrated database retrieval system