KEGG   Rhodoferax saidenbachensis: RS694_18375Help
Entry
RS694_18375       CDS       T04623                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00564  Glycerophospholipid metabolism
rsb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RS694_18375
Enzymes [BR:rsb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RS694_18375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Thi4 Pyr_redox_2 FAD_binding_3 HI0933_like Lycopene_cycl 3HCDH_N Pyr_redox_3 NAD_binding_8 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: APW44978
UniProt: A0A1P8KG73
LinkDB All DBs
Position
complement(3858738..3860345)
Genome map
AA seq 535 aa AA seqDB search
MTTNAQALPTRRADLLERLRDCTRYDIAIVGGGATGLGVALDAVTRGLKVVLVESHDFAK
GTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLAFVMPSYQWWETPF
YGVGLKMYDALAGKAGLGKTEFLGRDATLASLPQANPAHLKGGVKYWDGQFNDARLAITL
AKTAALHGALLVNYCKAADLIYKDGKVAGLVCEDTETGAQIEVHAGCVINAAGVWVDELR
QKDGAANAHDGRRPTKAMVAPSQGVHIVVDREFLDSEVALMVPKTADGRVLFAVPWLGKV
ILGTTDTPRHDLAREPLPFKEEVDFILSEAARYLRRAPKKEDIRSIWVGLRPLVKPQDDD
GDNTKGLSREHTVLVSRSGLVTVTGGKWTTYRAMAEDVLQKCVDKRLIHCDKKPVTAHLN
LLGAGLAGAAPVSISLPAGGHSYGSEAVQLLVMPGADVTLTPGLTEAMVRYAARNEYART
VEDVLARRSRLLFLDARLAGTLATRVAAILQEETGQDPQIDAFFALVQQYLELPA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaatgcccaagccttgcctacccgccgtgccgatttgctggagcgcctgcgc
gactgtacccgctatgacatcgccatcgtcggcggcggcgctaccggattaggcgtggca
ctggatgccgtgacccgtggcctgaaagtggtgctggtggagtcccacgactttgccaaa
ggcacgtcgtcccgtgcgaccaaactcgtgcatggcggcgtgcgttacttggcgcagggc
aatatcgccctggtgcgcgaggccctgcacgagcgcaccacgcttttgcacaatgcgccc
catctggcgcagccgttggcctttgtcatgccgtcctaccagtggtgggaaacgcctttc
tatggtgtgggtctgaagatgtacgacgcactcgccggcaaggcggggctgggaaaaacc
gaatttctggggcgggatgcaaccctggcttcgctgccacaggccaaccccgcgcatctc
aagggcggcgtgaagtactgggacggccagttcaacgacgcccgtttggccattaccctg
gccaaaacggcggcgttgcacggtgccttgttggtcaattactgcaaggcggcagacctt
atttataaggatggcaaggttgctggcttggtctgcgaagacaccgaaaccggtgcgcaa
atcgaggtgcacgctggatgtgtcatcaatgccgcgggcgtgtgggtcgacgaattgcgc
caaaaagacggtgctgccaacgcccatgacggccgtcgccccaccaaagccatggtggcg
cccagccagggtgtgcatatcgtggtggaccgggagtttctggactccgaggtggcgctg
atggtgcccaaaaccgccgatggccgggttttatttgcggtgccgtggctgggcaaggtt
attttggggacgaccgacaccccccgccatgacttggcccgagagcccctgccgttcaag
gaagaagtggacttcatattgagtgaggcggcccgttatctgcgccgtgcccccaagaaa
gaagacattcgcagtatctgggttgggctgcggcccttggtcaaaccccaggatgacgac
ggcgacaacaccaagggcctgagccgcgagcacacggtgctggtcagccgcagcggcttg
gtgacggtgaccggcggcaaatggacgacttaccgcgcgatggctgaagacgtcttgcag
aaatgcgtggacaagcgtcttatccattgcgataaaaagccagtgactgctcacttaaat
ctgctgggtgcgggcctggcgggtgccgccccggtgtccatcagtttgcccgcaggcggc
cattcctacgggtcggaagcggtgcaactgttggtcatgccgggagcggatgtgacgctg
acgcccggtttgacggaggccatggtgcgttatgcggcgcgcaatgaatatgcgcgcacc
gtggaagatgtgctggcccggcgttcgcgtctgctgtttctggatgcgcgcctggcgggc
actttggcgacacgggtggcggcaatattgcaagaagaaaccggacaagacccgcaaatc
gacgctttttttgcgttggtgcagcagtatttggagttgccggcctaa

DBGET integrated database retrieval system