KEGG   Runella slithyformis: Runsl_0157Help
Entry
Runsl_0157        CDS       T01553                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
rsi  Runella slithyformis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rsi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Runsl_0157
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Runsl_0157
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Runsl_0157
Bacterial toxins [BR:rsi02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Runsl_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
192964..194307
Genome map
AA seq 447 aa AA seqDB search
MSKGHKEGGTTLVLFGKIVSGLPPLAVLFIHYVLLNKKVIVSLSTVQLPAKMHLRLFLLL
LIPTLTIAQTSADLHSPKETVVFQNGQNGYKCYRIPAIVKAPNGDLLAFAEARRNNCGDF
GDVEIVMKRSTDNGASWGKLQVVADNSNDQAGNPAPVFDLTDKRFSKGRLFLFYNTGIAH
EQEVREGKAIREVWYKTCTDNGQTWSAPVNITTQVSKPNKPDVNPAYTFKEDWRSYANTP
GHGLQLQKGKYRGRIFIAANHSAGPPQKQSRDYVAHAFYSDDHGKTFKLSPNVAYAGSNE
AIAAETSDGSLLFNCRNQSGDAKYRIQAFTKNAGETWDEVKVMTDLPDPICQGSIIDFQP
KKGKKVLIFSNNNSQTQRDKLTVRVSYDNGRSWSAGKEIYGAAKSYEDPSAYSDLVVQQD
NSLGVLYEKNDYTQIVYAQFSYDWLVQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagggtcacaaagagggaggcacgaccttagtgctgtttgggaaaattgtatca
ggtctaccgcccttggcagtactttttattcattatgttcttttgaataaaaaagttatt
gtatcactaagcaccgtccaactccctgcaaaaatgcatttacgactgtttctactttta
ctgattcccacgttaaccatcgcccaaacctctgctgacctgcattcaccgaaagaaacg
gtagtgtttcagaacggacaaaacggctacaaatgctaccgcattccagccattgtcaaa
gctcccaacggcgacttactggcttttgccgaagcaaggcgcaataactgcggggatttt
ggcgatgtagaaattgtcatgaaacgcagcaccgacaacggcgcttcgtggggaaaactg
caagtggttgccgacaacagcaacgaccaggcaggcaatcccgcgcccgtctttgatctg
accgataaacgcttttcaaaaggccgattgtttttattctacaatacaggtatagcccac
gagcaggaagtgcgcgaaggaaaagccattcgggaagtgtggtacaaaacctgcaccgac
aacggccaaacgtggtcggccccggtcaatatcacaacgcaggtgtccaaacccaataaa
cccgatgtcaaccccgcctatacgttcaaagaagattggcgctcctatgccaacacgccc
gggcacggcctgcaactgcagaaaggcaaatacaggggccgcattttcatcgcggccaat
cactcagccgggccgccgcaaaagcaatcccgtgattacgtggcccacgctttttacagc
gatgaccacggcaaaaccttcaaactttcgcccaatgtagcctacgcgggcagcaacgaa
gccattgccgccgaaacctccgacggaagcctgctttttaactgtcgtaaccaatccggc
gatgctaagtatcgcattcaggctttcaccaaaaacgccggcgaaacctgggacgaagta
aaagtcatgaccgacctccccgaccctatttgccaagggagtatcattgattttcaaccg
aaaaaaggcaaaaaagtgttgattttttctaacaacaacagccaaacccaacgcgataaa
ctgaccgtcagggtgagttatgacaacggtagaagctggtcggccggcaaagagatttat
ggcgcggcaaaatcctatgaagacccgtcggcgtattcggatctggtcgtgcagcaggac
aattcccttggagtgttgtatgaaaaaaatgattatacacagatcgtttacgcccaattc
agctatgattggctggtacaatag

DBGET integrated database retrieval system