KEGG   Rhodobacter sphaeroides KD131: RSKD131_2357Help
Entry
RSKD131_2357      CDS       T00844                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSKD131_2357
  Amino acid metabolism
   00310 Lysine degradation
    RSKD131_2357
   00380 Tryptophan metabolism
    RSKD131_2357
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RSKD131_2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(2398250..2401228)
Genome map
AA seq 992 aa AA seqDB search
MSGAAMTEQSPNAQFHASSFLQGQNAEYIDQLQARYAEDPASVDAGWAELFRSLGDSELD
AKRQAHGPSWSRTDWPPMPADDLTAALTGEWPAAPAKEAKAAGQKIQAKAAEQGVSLSDA
QVQRAVLDSIRALMIIRAYRIRGHLAADLDPLGLRNTTNHPELDPKSYGFTDADMDRPIF
IDNVLGLQVASMRQIVDIVKRTYCGTFALQYMHISDPEQAAWLKERIEGYGKEIHFTREG
RRAILNKLVEAEGFEKFLHVKYMGTKRFGLDGGEALIPAMEQIIKRGGALGVKEIVVGMP
HRGRLSVLANVMAKPYRAIFNEFQGGSFKPEEVDGSGDVKYHLGASSDRDFDGNTVHLSL
TANPSHLEAVNPVVLGKVRAKQEQAGDKTRHTVLPILLHGDAAFAGQGVVAECFGLSGLV
GHRTGGTIHIVVNNQIGFTTAPSFSRSSPYPTDIALMVEAPIFHVNGDDPEAVVHAAKVA
TEFRQKFHKDVVIDIFCYRRFGHNEGDEPMFTNPSMYTSIKKHKTTLQLYTERLVRDGLI
PEGEIEDMKAAFQAKLNEEFEAGKDFKPNKADWLDGRWKHIDRHGDEYQPGRTSISAETL
QEIGQALTRVPEGFDLHKTVGRQLEAKKQMFETGRGFDWATGEALAFGSFVVEGYPVRLS
GQDCTRGTFSQRHSAFINQSTEERYYPLNNIRSGQARYEVIDSMLSEYAVLGFEYGYSLA
EPNALVMWEAQFGDFANGAQIMFDQFINSGESKWLRMSGLVVLLPHGFEGQGPEHSSARL
ERFLQMSANDNWIVANCSTPANYFHILRRQIHRNFRKPLILMTPKSLLRHPLCISNAEDF
TTGSGFHRVLWDDAQKGHSETVLKPDEQIRRVVMCSGKVYYDLLAERDKRGIDDIYLMRL
EQFYPFPALSLVKELGRFKNAEIVWCQEEPKNQGGWTFVEPNLEWVLTRIGASHTRAIYA
GRSASASPATGLASRHKAEQDALVNDALTIGS
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggtgcagccatgacggaacagtctccgaacgcgcagttccatgcctcgagtttc
ctccaggggcagaatgccgagtatattgaccagttgcaggcacgttatgccgaagacccc
gcctccgtcgatgcgggctgggcggagttgttccgttcgctgggcgacagcgagctcgac
gccaagcgtcaggcgcatggcccctcctggtcgcggaccgactggccgccgatgccggcg
gacgacctgaccgccgcgctgaccggcgaatggcccgccgcccctgccaaggaggcgaag
gctgccgggcagaagattcaggccaaggccgccgaacagggcgtgagcctcagcgacgcc
caggtgcagcgcgccgtgctcgattcgatccgggcgctgatgatcatccgggcctaccgg
atccgcggccacctcgccgccgatctcgatccgctcgggctgcgcaacaccacgaaccac
cccgagctcgacccgaagtcctacggctttaccgatgccgacatggaccggccgatcttc
atcgacaatgtgctcggtcttcaggtcgcttccatgcggcagatcgtggatatcgtcaag
cgcacctactgcggcacttttgcgctgcaatacatgcatatttccgaccccgaacaggcg
gcctggctcaaggagcgcatcgagggctacggcaaggagatccacttcacccgcgagggc
cggcgtgcgatcctgaacaagctggtcgaggccgaaggcttcgagaagttcctccatgtc
aagtacatgggcaccaagcgcttcggtctcgacggcggcgaggcgctcatccccgccatg
gagcagatcatcaagcgcggcggcgcgctcggcgtgaaggagatcgtggtgggcatgccg
caccgcggccgcctctcggtgctggccaacgtgatggccaagccctaccgcgccatcttc
aacgaattccagggcggcagcttcaagccggaagaggtcgacggctcgggcgacgtgaaa
tatcacctcggcgcctcctcggaccgtgacttcgacggcaacaccgtccacctgtcgctg
accgcgaacccctcgcacctcgaggcggtgaacccggtcgtgctgggcaaggtccgcgcc
aagcaagagcaggccggcgacaagacgcgccacacggtcctgccgatcctgctgcacggc
gacgcggcctttgcggggcagggcgtcgtggccgaatgcttcggcctgtcgggcctcgtc
ggtcaccgcaccggcggcaccatccatatcgtggtgaacaaccagatcggcttcaccacc
gcgccgtccttctcgcgctcctcgccctatccgaccgacatcgcgctgatggtcgaggca
ccgatcttccatgtgaacggcgacgatcccgaggcggtggtccatgccgccaaggtggcg
accgagttccggcagaagttccacaaggatgtcgtcatcgacatcttctgctaccgccgc
ttcggccacaacgagggggatgaaccgatgttcaccaacccctcgatgtatacctcgatc
aagaagcacaagacgacgctccagctctataccgagcgtctggtgcgcgacgggctgatc
cccgagggcgagatcgaggacatgaaggccgccttccaggccaagctcaacgaggagttc
gaggccggcaaggacttcaagcccaacaaggccgactggctggacgggcgctggaagcac
atcgaccggcacggcgacgaatatcagccgggccgcacctcgatctcggccgagacgctg
caggagatcggtcaggcgctgacgcgcgtgcccgagggcttcgacctgcacaagaccgtc
gggcgccagctcgaggccaagaagcagatgttcgagaccggccgcggcttcgactgggcg
acgggcgaggctttggccttcggctcgttcgtggtcgagggctatccggtgcgcctctcg
gggcaggactgcacccgcggcaccttcagccagcggcattcggccttcatcaaccagtcg
accgaggaacgttactacccgctgaacaacatccggtcgggtcaggctcgctacgaggtc
atcgactcgatgctgtcggaatatgccgtgctcgggttcgaatacggctattcgctggcc
gagcccaacgcgctggtgatgtgggaagcccagttcggcgatttcgccaacggcgcccag
atcatgttcgaccagttcatcaactcgggcgaatcgaagtggctgcgcatgtcgggcctc
gtggtgctgttgccgcacggcttcgaggggcagggccccgagcactcctcggcccggctc
gagcggttcctccagatgtcggccaacgacaactggatcgtggccaactgctcgacgccc
gcgaactacttccacatcctgcggcggcagatccaccggaacttccgcaagccgctgatc
ctgatgacgccgaagtcgcttctgcgccacccgctctgcatctcgaacgccgaggatttc
accaccggctcgggcttccaccgggtgctgtgggacgatgcgcagaagggccactccgag
acggtgctgaagcccgacgagcagatccgccgcgtcgtcatgtgctcgggcaaggtctac
tacgacctcctggccgaacgcgacaagcggggcatcgacgacatctacctgatgcgcctc
gagcagttctatcccttcccggcgctgagcctcgtgaaggagctgggccgcttcaagaat
gccgagatcgtctggtgtcaggaagagccgaagaaccagggcggctggaccttcgtcgag
ccgaacctcgaatgggtgctgacgcggatcggcgccagccacacgcgtgccatctatgcc
ggccggtcggcctcggcctcgcccgccacgggtctcgccagccgccacaaggccgagcag
gacgcgctggtgaatgacgcgctgacgatcgggagctga

DBGET integrated database retrieval system