KEGG   Ralstonia solanacearum PSI07: RPSI07_mp0202Help
Entry
RPSI07_mp0202     CDS       T01273                                 

Gene name
TreS
Definition
(GenBank) Trehalose synthase, Maltose alpha-D-glucosyltransferase; Alpha amylase, catalytic subdomain
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RPSI07_mp0202 (TreS)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RPSI07_mp0202 (TreS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RPSI07_mp0202 (TreS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
mpPSI07:complement(242291..245773)
Genome map
AA seq 1160 aa AA seqDB search
MTRNPTVLLVDDALWYKDAVIYQLHVKSFCDSNNDGVGDLPGLISKLDYIAELGVDAVWL
LPFYPSPRRDDGYDIADYRGVHPDYGTMADARRFIAEAHARGLRVITELVINHTSDQHPW
FQRARRAKSGSALRDFYVWSDHDKKYAGTRIIFIDTEPSNWTWDPVANAYYWHRFYSHQP
DLNFDNPRVLKAVLGVMKFWLNLGVDGLRLDAVPYLVEREGTANENLPETHAVLRKIRAA
MDAEFKNRLLLAEANQWPEDTQEYFGDGDECHMAFHFPLMPRMYMAIAREDRFPITDIMR
QTPEVPSACQWAIFLRNHDELTLEMVTDAERDYLWEVYASDRRARLNLGIRRRLAPLLER
DRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRDGVRTPMQWSPDRNGGFSRADP
EQLVLPAIMGSLYGYESVNVEAQTRDAHSLLNWTRRMLATRKRHRVFGRGSIQFLHPANR
KVLAYVRALEGEAPILCVANLSRASQAVELDLAAYAQRVPVELIGGTAFPPIGQLPYLLT
LPPYAFYWLELRENEPGPSWAQPAAEQLPEFTTLVLRAGLDALSDTRQREAHRQLIEREI
LPSYLPKRRWFAAKDSVLRGAHFVWGATVPVDASSTNRPLAGATRPEIFINEIAVTLGDA
DGTERTERYLLPLSIAWESATLPALPIQLALARVRRGRHVGYLTDAFTTETFARALLAGL
VRGVTLEANEGTVRFEPEPNLVEPAEPAPEADAGAARPAPLPLAPDAPVRWLAAEQSNSS
LVIGESIIVKLIRRVAAGVHPEVEMTRHLTRIGYANTAALIGEIAHVSAAGERSTLAVIQ
SFVPNQGDAWTWALDYLRRTIDELAVLTEAVSTGDGEAAPAAVSEARTDTDEALAGYLAF
IGGIGTRLGELHVALASPSKDAAFGTSAANADDAAYWIACVSEQVTRALDHLAAWQAING
SNADLDWLLSQRDALLAAARERAQGGLGALLARIHGDFHLGQVLVAQGDAFLIDFEGEPS
RPVEERRRKTSPLRDVAGLVRSLDYVVGAMRQGPEHVAGPAQERRDQLLERFRNASTERF
LDAYAAAVQAPESDDGACALDMDLLDLFLLEKAAYEVNYEAANRPSWLPIPLTGLARVAR
RLLHAEVPSPAVQDPPGGPP
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaacccgaccgtgctgctggtggacgacgcgctctggtacaaggacgcggtc
atctaccaattgcacgtcaagtcgttctgcgattcgaacaacgatggcgtgggcgactta
ccgggcctgatctccaagctcgactacatcgccgagctgggcgtggacgcggtctggctg
ctgccgttctacccctcgccgcgccgcgacgacggctacgacatcgccgactaccgtggc
gtgcatccggactacggcaccatggccgatgcgcgccgcttcattgccgaggcgcacgcg
cgcggcctgcgcgtgatcaccgagctggtcatcaaccacacctcggaccagcacccgtgg
ttccagcgcgcgcgccgcgccaaatcgggctcggcgctgcgcgacttctacgtgtggtcg
gaccacgacaagaaatacgccggcacgcgcatcatcttcatcgacaccgagccctccaac
tggacctgggacccggtggccaacgcctactactggcaccgcttctattcgcaccagccc
gacctgaacttcgacaacccgcgcgtgctcaaggctgtgctgggcgtgatgaagttctgg
ctcaacctgggcgtggacggcctgcggctggatgccgtgccctacctggtggagcgcgag
ggcaccgccaacgaaaacctgcccgagacgcacgccgtgctgcgcaagatccgcgcggcg
atggacgcggagttcaagaaccgcctgctgctggccgaggccaaccagtggcccgaagac
acacaggaatacttcggcgacggcgatgaatgccacatggccttccactttccgctgatg
ccgcgcatgtacatggcgatcgcgcgcgaagaccgctttccgatcaccgacatcatgcgg
cagacgcccgaggtgccctccgcctgccagtgggccatcttcctgcgcaaccacgatgag
ctgacgctggagatggtgaccgacgcggagcgcgactacctgtgggaggtctacgccagc
gaccgccgcgcgcggctgaacctcggcatccgccggcgcctggcgccgctgctggagcgc
gaccgccgccgggtcgagctgatgaacagcctgctcttctcgatgcccggcacgccggtg
atgtactacggcgacgagatcggcatgggcgacaacatccacctgggcgaccgcgacggc
gtgcgcacgccgatgcagtggtcgcccgaccgcaacggcggcttctcgcgcgccgatccg
gagcagctggtgctgccggccatcatgggctcgctgtacggctatgaatcggtcaacgtg
gaggcgcagacgcgcgatgcgcattcgctgctgaactggacgcgccggatgctcgccacg
cgcaagcggcatcgcgtgttcgggcgcggcagcatccagttcctgcatccggccaaccgc
aaggtgctggcctatgtgcgcgcgctggaaggcgaggctcccatcctgtgcgtggcgaat
ctgtcccgggcctcgcaggcggtggagctggacctggccgcctatgcgcagcgcgtgccg
gtggagctgatcggcggcacggccttcccgccgatcggccagttgccttatctgctgacg
ctgccgccctatgcgttctattggctggagctgcgcgagaacgagcccggcccgtcatgg
gcgcagccggcggcggagcagttgcccgagttcaccacgctggtgctgcgtgccgggctc
gacgcgctgtccgacacgcgccagcgcgaggcccatcgtcaactgatcgaacgcgagatc
ctgccgagctatctgcccaagcgccgctggtttgcggccaaggacagcgtattgcgcggt
gcgcatttcgtgtggggcgcgacggtgccggtggatgcctcgtcgaccaaccgaccgctg
gcgggcgcgacccggcccgagatcttcatcaacgagatcgccgtcacgctgggcgatgcg
gatggcaccgagcgcacggaacgctacctgttgccgctgtccatcgcgtgggaatcggcc
acgctgcccgcgctgccgatccaactggcattggcacgggtacggcgcggccgccatgtc
ggctacctgaccgacgccttcaccaccgagaccttcgcccgcgcgctgcttgccggcctc
gtacgcggcgtcacgctcgaagccaatgaaggcaccgtgcgcttcgaacccgagcccaac
cttgtcgaaccggccgagcccgccccggaagccgacgccggcgccgcccggccggcaccg
ttgccgctggcgcccgacgcaccggtgcgatggctggcggcagagcagtccaacagttcg
ctggtgatcggcgaatccatcatcgtcaagctgatccgccgcgtggcggccggcgtgcat
ccggaagtggagatgacgcgccacctcacgcgcatcggctatgccaacacggccgcgctg
atcggcgagatcgcgcatgtgagcgccgccggcgagcgcagcacgctggccgtgatccag
agcttcgtgcccaaccagggcgacgcctggacgtgggcgctcgactacctgcgccgcacc
atcgatgaactggcggtgctgaccgaggcggtctcgacgggcgacggcgaagcggcaccc
gctgccgtgtcggaagcgcgcaccgataccgacgaggcgctggcgggctacctggccttc
atcggcggcatcggcacgcggctgggcgagctgcatgtcgcgctggcgtcgccgtcgaaa
gacgccgccttcggcaccagcgctgccaatgccgacgacgccgcctactggatcgcgtgc
gtgagcgagcaggtcacccgcgcgctcgatcacctggcggcctggcaggcgatcaacgga
tcgaacgcggacctcgactggctgctgtcgcagcgcgatgccctgctggcagccgcccgc
gaacgcgcgcagggcggcctgggcgcgctgctggcgcgcatccacggcgacttccacctc
ggccaggtgctggtggcgcagggcgacgccttcctgatcgacttcgagggcgagccgtcg
cggccggtggaagagcgccggcgcaagaccagcccgctgcgtgacgtggccgggctggtg
cgctcgctcgactacgtggtgggcgccatgcggcagggccccgaacatgtggccgggccg
gcgcaggagcggcgcgaccagttgctcgaacgcttccgcaacgcctccaccgagcgcttc
ctggacgcgtatgcggcggccgtccaggcccccgaatccgatgacggcgcctgcgcgctc
gatatggacctgctggacctgttcctgctggagaaagcagcctacgaggtcaattacgaa
gccgccaaccggccgagctggctgccgatcccgctgactggcctggcgcgcgtggcgcgc
cggctgctgcacgcggaagtgccatcgcccgcggtgcaggatccgcccggaggcccacca
tga

DBGET integrated database retrieval system