KEGG   Ralstonia solanacearum GMI1000: RSc2358Help
Entry
RSc2358           CDS       T00071                                 

Gene name
ppc
Definition
(GenBank) probable phosphoenolpyruvate carboxylase (pepcase) (pepc) protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rso00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSc2358 (ppc)
  Energy metabolism
   00680 Methane metabolism
    RSc2358 (ppc)
Enzymes [BR:rso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RSc2358 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2558095..2561052
Genome map
AA seq 985 aa AA seqDB search
MTQSAARRASSRATPARKTPPAPASQTPAPSPGGTAGTALGPTSRRSSGSAAAKDQPLKE
DIRFLGRLLGDVLREQEGAAAFETVETIRQTAVRFRRDGDRQAEQELDRLLKTLSRDQTT
SVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSSPQPGSLLRALLSAADEGLSGDALRRF
FDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDAPLTVRERERNVTLLRAHVTKLW
QTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEEDVATVFPRRGARGEPAPLPA
FFQMGSWIGGDRDGNPFVTAQTLRHAAQRQASVILTWYLDEIHALGAELSMSTLLVDVSA
DLLALAERSPDHSEHRADEPYRRALIGVYARLAATCRELTGEDAGRHAVGPAPAYTRAEE
LRADLQIVIDSLAAHHGEALADARLASLARAIDVFGFHLASIDLRQVSDVHEATVAELLR
VAGVEGAYAALSEADKRTLLLRELQQPRLLTLPFHTYSETTASELDIFRAAREVRARYGS
RIVRNYIISHTETLSDLLEVMLLQKEAGMFRHGTNGSGGAGLDVMVIPLFETIEDLRNAP
QIMGELLALPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSNWELYKTELALVELFERKG
VRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEIISSKFANPEIGRRNLE
TIVAATLEATLLPTRNRPKGLEEFEAAMQALSDHAFSAYRHLVYETPGFKDYFFATTPIT
EIADLNLGSRPASRKLMDRKQRRIEDLRAIPWGFSWGQCRLLLPGWFGFGSAVQRWLDEA
GSAKAKAARLATLKRMHKQWPFFANLLSNMDMVLSKADLNVASRYAQLCEDRKLRNAVFS
RISAEFTLTEQVLGAITGQSERLADNPLLARSIKNRFPYLDPLNHLQVELLKRFRSGKAG
SNDARVRRGIHLSINGIAAGLRNSG
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagtccgccgcgcgccgcgcatcctcgcgcgcgacccccgcgcgcaagacgcca
cccgcccccgccagccagaccccggcgccctcgcccggcggcacggccggcaccgccctg
ggcccgacctcgcgccggtcctccggcagcgcggcggccaaggaccagccgctcaaggag
gacatccgcttcctcgggcgcctgctgggcgacgtgctgcgcgagcaggaaggcgccgcc
gccttcgagaccgtcgagaccatccgccagaccgcggtgcgcttccgccgcgacggcgac
cgccaggccgagcaggagctcgaccggctgctcaagacgctgtcgcgcgaccagaccacc
tcggtggtgcgcgccttcagctacttctcgcacttggccaacatcgccgaagaccagcac
cataaccgccgccgccgcgtgcacgcgctggccggctcgtcgccgcagccgggcagcctg
ctgcgcgcgctgctgtcggcggccgacgagggcctctcgggcgatgcgctgcggcgcttc
ttcgacgccgcgctgatcgtgccggtgctgacggcccacccgaccgaagtgcagcgcaag
agcattctcgacgcgcagcgcgagatcgcccgcctgctggccgagcgcgatgcgccgttg
accgtgcgcgagcgcgagcgcaacgtcaccctgctgcgcgcccacgtcaccaagctgtgg
cagacgcgcatgctgcgcaccacgcgcctgatggtggccgacgagatcgagaacgcgctg
tcgtactaccagaccaccttcctgcgcgagattcccgcgctgtaccgcgagctggaagag
gacgtcgccacggtgttcccgcgccggggcgcgcgcggcgagccggccccgctgcccgcc
ttcttccagatgggctcgtggatcggcggcgatcgcgacggcaacccgttcgtcaccgcg
cagacgctgcgccatgccgcgcaacggcaggccagcgtgatcctcacgtggtacctcgac
gagatccacgcgctgggcgcggagttgtcgatgtccaccttgctcgtcgacgtgagcgcc
gacctgctggccctggccgaacgctcgcccgatcactccgagcaccgcgcggatgagcct
taccggcgcgcgctgatcggcgtgtatgcgcgcctggcggccacctgccgcgagctgacc
ggcgaggatgccggccgccacgcggtcggcccggcccccgcctacacgcgcgcggaggaa
ctgcgcgccgatctccagatcgtcatcgattccctcgcggcgcaccacggcgaggcgctg
gccgatgcgcggctggcctcgctggcgcgggcgatcgacgtgttcggcttccacctcgcg
tcgatcgatctgcgccaggtgtcggacgtgcacgaggccaccgtggccgagctgctccgg
gtggccggcgtggaaggcgcctatgcggcgctgtcggaagccgacaagcgcacgctgctg
ctgcgcgagctgcagcagccgcgcctgctgacgctgcccttccacacctacagcgagacg
accgcgtcggagctcgacatcttccgtgccgcgcgcgaggtgcgcgcgcgctacggcagc
cgcatcgtgcgcaactacatcatctcgcacaccgagacgctgtcggacctgctggaagtg
atgctgctgcagaaggaggcgggcatgttccgccacggcaccaacggcagcggcggcgcg
ggcctggatgtgatggtgatcccgctgttcgagaccatcgaagacttgcgcaacgccccg
cagatcatgggcgagctgctcgccctgcccggcttcgatgccgtgctggccgcgcagggc
aacgagcaggaagtgatgctcggctattcggattccaacaaggacggcggcttcctgacc
tccaactgggagctgtacaagaccgagctggcgctggtggagctgttcgagcgcaaaggc
gtgcgcctgcgcctgttccacggccgcggcggcacggtgggccgcggcggcggcccgacc
taccaggccatcctgtcgcagccgccgggcacggtgaacgggcagatccgcctgaccgag
cagggcgagatcatctccagcaagttcgccaaccccgagatcgggcggcgcaacctcgag
accatcgtggccgccacgctcgaagccacgctgctgcccacgcgcaaccggcccaagggg
ctggaggaattcgaggccgcgatgcaggcgctgtcggaccacgcgttctcggcctaccgc
cacctcgtctacgagaccccgggcttcaaggactacttcttcgccaccacgcccatcacc
gagatcgccgacctgaacctcggctcgcggccggcctcgcgcaagctgatggacaggaag
cagcgccgcatcgaagacctgcgcgcgattccgtggggcttctcgtggggccagtgccgg
ctgctgctgccgggctggttcggcttcggcagcgcggtgcagcgctggctggacgaggcc
ggcagcgccaaggcgaaggcggcgcgcctggcgacgctcaagcgcatgcacaagcaatgg
ccgttctttgccaacctgctctccaacatggacatggtgctgtccaaggccgacctgaac
gtggcttcgcgctatgcccagctgtgcgaagaccgcaagctgcgcaacgcggtgttctcg
cgcatctcggccgagttcacgctcaccgagcaggtgctgggggccatcaccggccagtcg
gagcggctggcggacaacccgctgctggcgcgctcgatcaagaaccgcttcccctacctc
gatccgctcaaccacctgcaggtggagctgctcaagcggttccgttcgggcaaggccggc
agcaacgatgcgcgcgtgcggcgcggcatccacctgtcgatcaacgggatcgcggcgggg
ctgcgcaatagcggctga

DBGET integrated database retrieval system