KEGG   Rhodobacter sphaeroides 2.4.1: RSP_1707Help
Entry
RSP_1707          CDS       T00284                                 

Gene name
tufA
Definition
(RefSeq) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
Translation factors [BR:rsp03012]
 Eukaryotic Type
  Elongation factors
   RSP_1707 (tufA)
 Prokaryotic Type
   RSP_1707 (tufA)
Mitochondrial biogenesis [BR:rsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RSP_1707 (tufA)
Exosome [BR:rsp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RSP_1707 (tufA)
  Exosomal proteins of breast cancer cells
   RSP_1707 (tufA)
  Exosomal proteins of colorectal cancer cells
   RSP_1707 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 3718904
NCBI-ProteinID: YP_351747
UniProt: Q3J5S4
LinkDB All DBs
Position
1:287813..288988
Genome map
AA seq 391 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITKYFGEFRAYDQIDGAPEERARGITIST
AHVEYESDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHILLGRQ
VGIPYMVVYMNKVDQVDDPELIELVEMEIRELLSSYDYPGDDIPIIKGSALAAMNGTDKE
IGEDSIRALIAAVDEYIPTPARAVDQPFLMPVEDVFSISGRGTVATGRIERGVVKVGEEL
EIVGIRPSKKTVCTGVEMFRKLLDQGEAGDNVGLLLRGVDRDGIERGQVLCKPGSVKPHT
KFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVQLPEGTEMVMPGDNLKFNVEL
IAPIAMEEKLRFAIREGGRTVGAGVVSKIIA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcaaagtttgaacgtaacaaaccgcacgtcaacatcggcacgatcggccac
gttgaccacggcaagacgactctgacggccgcgatcacgaagtatttcggcgagttccgc
gcctacgaccagatcgacggcgcgccggaagagcgggcccgcgggatcacgatctcgacc
gcgcacgtggaatacgagtcggacacgcgccactatgcgcacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggcgccgcgcagatggacggcgcgatcctcgtg
gtgaacgcggccgacggcccgatgccgcagacgcgcgagcacatcctgctcggccgtcag
gtgggcatcccctacatggtcgtctacatgaacaaggtcgaccaggtggacgatccggaa
ctcatcgagctggtcgagatggagatccgcgagcttctgtcgtcctacgactaccccggc
gacgacattccgatcatcaagggctcggctctggccgcgatgaacggcaccgacaaggaa
atcggcgaggattcgatccgcgcgctgatcgccgccgtggatgaatacatcccgaccccg
gcgcgtgccgtggaccagcccttcctgatgccggtcgaggacgtgttctcgatctcgggc
cgcggcaccgtggccacgggccggatcgagcgcggcgtggtgaaggtgggcgaggaactc
gagatcgtcggcatccgcccgtcgaagaagacggtctgcaccggcgtcgagatgttccgc
aagctcctcgaccagggcgaagcgggcgacaacgtgggcctgctgctccgcggcgtggac
cgcgacggcatcgagcgcgggcaggttctctgcaagccgggctcggtgaagccgcacacg
aagttcgaggccgaggcctacatcctcacgaaagaggaaggcggccgccacaccccgttc
ttcgcgaactaccgtccgcagttctacttccggaccaccgacgtgaccgggaccgtgcag
ctgccggaaggcaccgagatggtgatgccgggcgacaacctgaagttcaacgtcgagctg
atcgcgccgatcgccatggaagagaagctccgcttcgccatccgtgaaggcggccgcacc
gtcggcgccggcgtcgtctcgaaaatcatcgcctga

DBGET integrated database retrieval system